PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011085926.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family MYB_related
Protein Properties Length: 481aa    MW: 52945.3 Da    PI: 7.6697
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011085926.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.84.4e-1762106147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      r rWT+eE++++++a k++G   W++I +++g ++t+ q++s+ qk+
   XP_011085926.1  62 RERWTEEEHKKFIEALKLYGRA-WRKIEEHVG-TKTAVQIRSHAQKF 106
                      78******************88.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.5E-1656110IPR009057Homeodomain-like
PROSITE profilePS5129422.04157111IPR017930Myb domain
Gene3DG3DSA:1.10.10.605.2E-1059110IPR009057Homeodomain-like
TIGRFAMsTIGR015579.8E-1760109IPR006447Myb domain, plants
SMARTSM007178.1E-1461109IPR001005SANT/Myb domain
PfamPF002491.8E-1462105IPR001005SANT/Myb domain
CDDcd001674.92E-1164107No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007623Biological Processcircadian rhythm
GO:0009734Biological Processauxin-activated signaling pathway
GO:0010600Biological Processregulation of auxin biosynthetic process
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 481 aa     Download sequence    Send to blast
MVATAMAVQE HTGSDAPLPT NDNIPFDLGT PTVKGNQLRE QFNAGDDFAP KARKPYTITK  60
QRERWTEEEH KKFIEALKLY GRAWRKIEEH VGTKTAVQIR SHAQKFFSKV VRESNTGDTS  120
SVKSIEIPPP RPKRKPSHPY PRKLVPPVKT GIRIPEKPSS SASPNTSEQE NQSPTSVLST  180
IGSDSSVGLD SCMPNSSPSP VSSGLPLNAG MISCSEAPKR LSEDADHEDE NSSPDEKIPL  240
ELELSSQNTA LVKEDPSESA AQSLKLFGKT LLVADPRGPS YLTPETCKAE SFDISDGSCS  300
FPLRVVPLKF PKCNYEYESS AFPDRSPVPV YTTDKLSPVD ARHPVPFPWL TLCSDASSST  360
QEVHSPIPIK AQLLCDKKEK LDNDEQKEGS STSSNTDNFL GASPDGGKNW GINSCHLSLK  420
RKGTEGKSFS SYKLSKRISA NSLNCRQGFV PYKRCFAEPE SNISKTETAE EREKQRIRFC  480
L
Functional Description ? help Back to Top
Source Description
UniProtMorning-phased transcription factor integrating the circadian clock and auxin pathways. Binds to the evening element (EE) of promoters. Does not act within the central clock, but regulates free auxin levels in a time-of-day specific manner. Positively regulates the expression of YUC8 during the day, but has no effect during the night. Negative regulator of freezing tolerance. {ECO:0000269|PubMed:19805390, ECO:0000269|PubMed:23240770}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00515DAPTransfer from AT5G17300Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_011085926.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Circadian-regulation. Peak of transcript abundance near subjective dawn. Down-regulated and strongly decreased amplitude of circadian oscillation upon cold treatment. {ECO:0000269|PubMed:19805390, ECO:0000269|PubMed:23240770}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011085926.10.0protein REVEILLE 1
SwissprotF4KGY61e-63RVE1_ARATH; Protein REVEILLE 1
TrEMBLA0A2Z7B6K31e-134A0A2Z7B6K3_9LAMI; Protein REVEILLE 1
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA31852447
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G17300.11e-52MYB_related family protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Xu G, et al.
    REVEILLE1 promotes NADPH: protochlorophyllide oxidoreductase A expression and seedling greening in Arabidopsis.
    Photosyn. Res., 2015. 126(2-3): p. 331-40
    [PMID:25910753]
  3. Jiang Z,Xu G,Jing Y,Tang W,Lin R
    Phytochrome B and REVEILLE1/2-mediated signalling controls seed dormancy and germination in Arabidopsis.
    Nat Commun, 2016. 7: p. 12377
    [PMID:27506149]