PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011085766.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family HD-ZIP
Protein Properties Length: 295aa    MW: 33800.6 Da    PI: 7.6691
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011085766.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox58.61e-1892145356
                     --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                     k+++++ eq+++Le+ Fe+ +++ a+++ +LA+ lgL+ rqV +WFqNrRa++k
  XP_011085766.1  92 KKRRLNLEQVKALERSFESGNKLEADRKMQLARALGLKPRQVAIWFQNRRARWK 145
                     4557899**********************************************9 PP

2HD-ZIP_I/II125.91.9e-4091183193
     HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelke 93 
                     ekkrrl+ eqvk+LE+sFe+ +kLe +rK++lar+Lgl+prqva+WFqnrRAR+ktkqlEkdy +Lkr+++ +k++n++L+++++eLr++l++
  XP_011085766.1  91 EKKRRLNLEQVKALERSFESGNKLEADRKMQLARALGLKPRQVAIWFQNRRARWKTKQLEKDYGVLKRQFELIKADNDALKSQNKELRSQLTA 183
                     69***************************************************************************************9975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.01E-1977149IPR009057Homeodomain-like
PROSITE profilePS5007116.76387147IPR001356Homeobox domain
SMARTSM003895.3E-1890151IPR001356Homeobox domain
PfamPF000466.3E-1692145IPR001356Homeobox domain
CDDcd000868.57E-1592148No hitNo description
Gene3DG3DSA:1.10.10.604.7E-1994154IPR009057Homeodomain-like
PRINTSPR000311.1E-5118127IPR000047Helix-turn-helix motif
PROSITE patternPS000270122145IPR017970Homeobox, conserved site
PRINTSPR000311.1E-5127143IPR000047Helix-turn-helix motif
PfamPF021833.6E-13147188IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 295 aa     Download sequence    Send to blast
MLFQSLAIFC QTRFLHTTFF ARERQSLAAE SMFRNHDDGH LPTLSSCAPQ DLNDVSQFLM  60
RRSMSYSRPF DVEELQPEDD MSDDGCQHLG EKKRRLNLEQ VKALERSFES GNKLEADRKM  120
QLARALGLKP RQVAIWFQNR RARWKTKQLE KDYGVLKRQF ELIKADNDAL KSQNKELRSQ  180
LTALRSRKST GSETINLNKD NEGSWSNGSL ENSSHDVKLN TTSTDSTIMF YHPNNNQGFV  240
SPSSVGAASL THILQSSSRT ADHLQASSNQ PHCSLFGGIE ENQEFWPWPE QQTFH
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1139147RRARWKTKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011085766.10.0PREDICTED: homeobox-leucine zipper protein ATHB-23-like
SwissprotQ8LC031e-67ATB13_ARATH; Homeobox-leucine zipper protein ATHB-13
TrEMBLA0A022R3B27e-99A0A022R3B2_ERYGU; Uncharacterized protein
STRINGVIT_01s0026g01950.t012e-82(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA8482498
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69780.17e-69HD-ZIP family protein