PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011085350.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family HD-ZIP
Protein Properties Length: 699aa    MW: 77665 Da    PI: 6.656
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011085350.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox60.52.7e-1945100156
                     TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                     r++ +++t+ q++e+e++F+++++p+ ++r+eL+++lg++  qVk+WFqN+R+++k
  XP_011085350.1  45 RKRYHRHTPRQIQEMEAFFKECPHPDDRQRKELSSELGMQPLQVKFWFQNKRTQMK 100
                     789999***********************************************999 PP

2START175.33.7e-552244461205
                     HHHHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS........SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EEE CS
           START   1 elaeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv.......dsgealrasgvvdmvlallveellddkeqWdetla....kae 80 
                     e+a +a++e+++ a++++p+Wv s     + +n++e+l++f++  v       ++ ea+r+s+vv m ++++ e+l+d+  +W++ +     +a+
  XP_011085350.1 224 EVAVAATEEVIRIAQVGDPLWVPSMdrnaTLLNEEEYLRSFSR--VfdlkldgFKCEASRESVVVAMSAPKVIEILMDVE-KWSNVFSgvvsRAK 315
                     57899********************999999**********55..6679*9**************************999.************** PP

                     EEEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE..TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEEEEEEE CS
           START  81 tlevissg......galqlmvaelqalsplvp.RdfvfvRyirq.lgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskvtwv 167
                      ++ issg      +alq+m+ae+ ++splvp R+++f+R+++q l++++w++vdvS+d   + +  +++v ++++pSg++i++++ng+skvtw+
  XP_011085350.1 316 HMQLISSGvgenynEALQVMNAEFHVPSPLVPtRESYFLRFCKQhLTDDTWTVVDVSLDGLHSAT--PQLVACRRRPSGCVIQDMPNGYSKVTWM 408
                     ***********************************************************999975..8*************************** PP

                     E-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXX CS
           START 168 ehvdlkgrlphwllrslvksglaegaktwvatlqrqce 205
                     ehv++++  +h+++++l+  gla+gak+wva l+ + +
  XP_011085350.1 409 EHVEVEDGGVHNIYKPLITAGLAFGAKRWVAILDAHSQ 446
                     **********************************9977 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.0E-2029100IPR009057Homeodomain-like
SuperFamilySSF466898.36E-1931102IPR009057Homeodomain-like
PROSITE profilePS5007116.45542102IPR001356Homeobox domain
SMARTSM003891.2E-1943106IPR001356Homeobox domain
CDDcd000863.22E-1845103No hitNo description
PfamPF000467.1E-1745100IPR001356Homeobox domain
PROSITE patternPS00027077100IPR017970Homeobox, conserved site
PROSITE profilePS5084837.272215450IPR002913START domain
CDDcd088754.12E-102221446No hitNo description
SuperFamilySSF559615.04E-29221446No hitNo description
PfamPF018529.1E-46224446IPR002913START domain
SMARTSM002348.0E-44224447IPR002913START domain
SuperFamilySSF559612.87E-16463688No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 699 aa     Download sequence    Send to blast
MVERQSFDMM NSNMSEEDDV RRTRGEEINS DSSNSNSIED QRPKRKRYHR HTPRQIQEME  60
AFFKECPHPD DRQRKELSSE LGMQPLQVKF WFQNKRTQMK TQHEHQENTQ LRSENEKLRA  120
ENMRYREALS NASCPTCGGP TPMAEASFHQ HQLRMENARL REEIDHISAV ATNYVGRPFA  180
NPTEAPSAST LASFKRTCRA TDLGRPAMDN AGQDVDRYRL MAIEVAVAAT EEVIRIAQVG  240
DPLWVPSMDR NATLLNEEEY LRSFSRVFDL KLDGFKCEAS RESVVVAMSA PKVIEILMDV  300
EKWSNVFSGV VSRAKHMQLI SSGVGENYNE ALQVMNAEFH VPSPLVPTRE SYFLRFCKQH  360
LTDDTWTVVD VSLDGLHSAT PQLVACRRRP SGCVIQDMPN GYSKVTWMEH VEVEDGGVHN  420
IYKPLITAGL AFGAKRWVAI LDAHSQRLQR AAAPKADVTC LEGWKSILKL GERMVTRFCS  480
GVNASTGNSW TTLSGNGSEN VRVMTRNNMD DLSMPVGLHL TIATSFWLPI PPKKVFDFLR  540
DPHTRNKWDM LSNGGDVEEM MQIVSGKEIG NSVAIYQAKS ATSRQTTLLE SRTDPTASYV  600
VYAPIDMVCL NAILGGGDPS SIPLLPSGFA ILPDGPTGSQ GRGMAAEADS GGSLLTVALQ  660
VLVDPSPNAK VSLGSITVAN NLISCTVDKI KNALIPKSS
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that may be involved in protoderm differentiation and radial pattern formation during early embryogenesis. {ECO:0000269|PubMed:11846882}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_011085350.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020552079.10.0homeobox-leucine zipper protein ROC1-like isoform X2
SwissprotQ6ZAR00.0ROC1_ORYSJ; Homeobox-leucine zipper protein ROC1
TrEMBLA0A2G9GLU10.0A0A2G9GLU1_9LAMI; Uncharacterized protein
STRINGMigut.H01063.1.p0.0(Erythranthe guttata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA9322491
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G05230.40.0homeodomain GLABROUS 2
Publications ? help Back to Top
  1. Lee JH, et al.
    Characterization of Arabidopsis and rice DWD proteins and their roles as substrate receptors for CUL4-RING E3 ubiquitin ligases.
    Plant Cell, 2008. 20(1): p. 152-67
    [PMID:18223036]
  2. Yi J, et al.
    OsMPK6 plays a critical role in cell differentiation during early embryogenesis in Oryza sativa.
    J. Exp. Bot., 2016. 67(8): p. 2425-37
    [PMID:26912801]
  3. Dou M,Cheng S,Zhao B,Xuan Y,Shao M
    The Indeterminate Domain Protein ROC1 Regulates Chilling Tolerance via Activation of DREB1B/CBF1 in Rice.
    Int J Mol Sci, 2016. 17(3): p. 233
    [PMID:26927068]
  4. Chou IT,Gasser CS
    Characterization of the cyclophilin gene family of Arabidopsis thaliana and phylogenetic analysis of known cyclophilin proteins.
    Plant Mol. Biol., 1997. 35(6): p. 873-92
    [PMID:9426607]