PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011085123.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family LBD
Protein Properties Length: 172aa    MW: 18979.6 Da    PI: 8.0024
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011085123.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260137.45e-43111101100
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     +Ca+Ck+lrr+CakdCv+ap+fp+++p+kfa+vhk+FGasn++k+l++lp  +r da+sslvyeA ar+rdPvyG++g i+ lq+q++ql+ +la
  XP_011085123.1  11 PCASCKLLRRRCAKDCVFAPHFPSDHPHKFAIVHKVFGASNISKMLQELPLPQRADAVSSLVYEATARVRDPVYGCTGAISYLQSQVAQLQMQLA 105
                     7********************************************************************************************** PP

          DUF260  96 llkee 100
                     l+++e
  XP_011085123.1 106 LAQAE 110
                     *9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.09610111IPR004883Lateral organ boundaries, LOB
PfamPF031952.0E-4211108IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 172 aa     Download sequence    Send to blast
MGGSGTAGNS PCASCKLLRR RCAKDCVFAP HFPSDHPHKF AIVHKVFGAS NISKMLQELP  60
LPQRADAVSS LVYEATARVR DPVYGCTGAI SYLQSQVAQL QMQLALAQAE ILCNQIRQDQ  120
QLLPNTLQYL NETATQNNHM PQFHNFTSFD NKNVICSDSF KKDSVYGCDL VS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A4e-4471247127LOB family transfactor Ramosa2.1
5ly0_B4e-4471247127LOB family transfactor Ramosa2.1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_011085123.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011085123.11e-127LOB domain-containing protein 12-like
SwissprotQ8LBW35e-65LBD12_ARATH; LOB domain-containing protein 12
TrEMBLA0A2N9GRE82e-77A0A2N9GRE8_FAGSY; Uncharacterized protein
STRINGcassava4.1_033834m3e-73(Manihot esculenta)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30130.16e-55LBD family protein
Publications ? help Back to Top
  1. Penfield S, et al.
    Reserve mobilization in the Arabidopsis endosperm fuels hypocotyl elongation in the dark, is independent of abscisic acid, and requires PHOSPHOENOLPYRUVATE CARBOXYKINASE1.
    Plant Cell, 2004. 16(10): p. 2705-18
    [PMID:15367715]