PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011084886.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family LBD
Protein Properties Length: 155aa    MW: 17549 Da    PI: 8.2232
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011084886.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF2601278.7e-4013111199
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     +CaaCk+l+r+C+++C +apyf +++pkkfa vhk+FGasnv+k+l+++ e++red+++slvyeAe+r+rdPvyG++g i  lq+++ +l+++l 
  XP_011084886.1  13 SCAACKFLKRRCTPNCQFAPYFRSDEPKKFAKVHKVFGASNVSKILNEVGEDQREDTVNSLVYEAEVRLRDPVYGCIGAIALLQHRMVELQHDLI 107
                     6*******************************************************************************************998 PP

          DUF260  96 llke 99 
                     l+++
  XP_011084886.1 108 LARA 111
                     8876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089124.99112113IPR004883Lateral organ boundaries, LOB
PfamPF031952.0E-3913109IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 155 aa     Download sequence    Send to blast
MKSYQEQPRS SSSCAACKFL KRRCTPNCQF APYFRSDEPK KFAKVHKVFG ASNVSKILNE  60
VGEDQREDTV NSLVYEAEVR LRDPVYGCIG AIALLQHRMV ELQHDLILAR ARLASYVGHR  120
SLFLDDHGGS LMAPFLDIPE SNSLPSDQFG RFHFP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A1e-4381166114LOB family transfactor Ramosa2.1
5ly0_B1e-4381166114LOB family transfactor Ramosa2.1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_011084886.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020551201.11e-113LOB domain-containing protein 21-like
SwissprotQ9SRL86e-57LBD21_ARATH; LOB domain-containing protein 21
TrEMBLA0A4D9AD539e-73A0A4D9AD53_SALSN; Uncharacterized protein
STRINGXP_009786680.16e-69(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA4324669
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G11090.12e-59LOB domain-containing protein 21
Publications ? help Back to Top
  1. Weber AP,Weber KL,Carr K,Wilkerson C,Ohlrogge JB
    Sampling the Arabidopsis transcriptome with massively parallel pyrosequencing.
    Plant Physiol., 2007. 144(1): p. 32-42
    [PMID:17351049]