PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011084560.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family GRF
Protein Properties Length: 533aa    MW: 57756.9 Da    PI: 5.9391
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011084560.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC74.41.2e-23207250144
             WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkske 44 
                     d+epgrC+RtDGKkWRCsr+v + +k+CErHlhrgr rsrk++e
  XP_011084560.1 207 DPEPGRCKRTDGKKWRCSREVAPHQKYCERHLHRGRPRSRKPVE 250
                     79***************************************998 PP

2QLQ53.29.2e-19152186236
             QLQ   2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiq 36 
                     +FTaaQ+ +L++Q+++yKy+++++PvP++Ll++ +
  XP_011084560.1 152 PFTAAQWKELERQAMIYKYMISSVPVPAYLLFPFS 186
                     8******************************9975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009515.6E-12151187IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088807.9E-13152184IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166619.641152187IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166725.072207251IPR014977WRC domain
PfamPF088791.0E-19208250IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010114Biological Processresponse to red light
GO:0010218Biological Processresponse to far red light
GO:0080167Biological Processresponse to karrikin
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 533 aa     Download sequence    Send to blast
MEKEAKIGSG FGVSHKKSSS NSHIVSSMKM QEMDAQTETQ AFPSKICMMP THHQETNPGR  60
PFAGSNDHSG GGGGAGGGGG GGGMEPTTNK SGANEVVGNT YRDDISSSHG DDENLAESTH  120
MQPFDNFTPS YSSFNPFKSP DSGVMAANVG FPFTAAQWKE LERQAMIYKY MISSVPVPAY  180
LLFPFSRNFA GSSAASIGNG RYSRNGDPEP GRCKRTDGKK WRCSREVAPH QKYCERHLHR  240
GRPRSRKPVE VKNNGENHHK KTRLDQSRSL PTVQSSSTVS QEFVAANQPL LLFNAKTDLT  300
ICTPSYNETN RDLSVTVDEE MVGRDEGAEP PWLHPIEANM GLANEGFSVY SSNNAPIFHQ  360
DYVEQQPWDV FTYPNFEGQT GFVDTWSVDS MNITDNRNLE SCVSLNDGNG SPSLNLTMAM  420
AAADVLGEEM RSIQMGTSVI DHNIKDSMWL SPVSWELFAR GGPLGEALHP GSLVIGGSNP  480
ASPYNSISTP ATTVSSPSGV LQRTLFSHSD GSVCNSPTLG PPLTTEAAIQ WLN
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_011084560.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011084560.10.0growth-regulating factor 7-like isoform X1
TrEMBLA0A2G9HZL01e-170A0A2G9HZL0_9LAMI; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA70322230
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G53660.14e-36growth-regulating factor 7