PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011083914.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family TALE
Protein Properties Length: 618aa    MW: 68490.6 Da    PI: 7.3334
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011083914.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox29.71.1e-094544862254
                     SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
        Homeobox  22 nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                     ++yps++++  L++++gL+++qV++WF N R +
  XP_011083914.1 454 HPYPSEADKHMLSRQTGLSKNQVSNWFINARVR 486
                     89*****************************88 PP

2BELL108.44.4e-35309380172
            BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                     er+e+q++k kLl++l+eVd rY++y+eq+q+++++F+ ++g g+a+pYt lA+ a+SrhFrc+kdaia+q+
  XP_011083914.1 309 ERAEHQRRKMKLLTMLDEVDARYRRYCEQMQAIVNAFDSAVGRGAAAPYTGLAQTAMSRHFRCIKDAIAGQL 380
                     799******************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005741.1E-58239378IPR006563POX domain
PfamPF075266.1E-47243377IPR006563POX domain
PROSITE profilePS5007112.082427490IPR001356Homeobox domain
SMARTSM003892.9E-9430494IPR001356Homeobox domain
CDDcd000864.79E-11430491No hitNo description
SuperFamilySSF466891.8E-17431497IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.8E-28433496IPR009057Homeodomain-like
PfamPF059201.5E-18447486IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 618 aa     Download sequence    Send to blast
MSQSFLQEIS NFSNAYERSM TAKQQGDWML RVQGFEQDLS GQQSVPVYDT GGMLTEIINL  60
PWRKPAGTDD FSPDDQIRPN YPWPQKQHLL NEAASQLSFM NPHVKVPNSS DSSHLQGFHL  120
LSPVQEPDME TPSELSWIPG SSSGSFDLGR TTRIVEGQGL SLSLSSSLRN MESNKFDKTI  180
SLGHGELYFH SQELQAGPNS HNLCGSKDLG TNHQLFHSPR RVLDHGNQAH PGLVESARTG  240
PNILRNSRYL SAAQELLQEF CCVGKGQLKN QRLKNQDGNP NSAMDGGGDA AAGPSSSSKD  300
QHHPISPAER AEHQRRKMKL LTMLDEVDAR YRRYCEQMQA IVNAFDSAVG RGAAAPYTGL  360
AQTAMSRHFR CIKDAIAGQL KETCEGLGEK DVGGGGGLTR GETPRLKLLE QKYRQQKSLQ  420
RVGMLDPESW RPQRGLPDGS VNILRAWLFD HFLHPYPSEA DKHMLSRQTG LSKNQVSNWF  480
INARVRLWKP MVEEMYQQEF REEVQPATAP KEETTSEPSS QTPTHKTGAT TTAPPPISLS  540
RTENEKGPSI NNTSSAACED SPTREYRCFM ADAAAGMMVR AGSQAGDVSL TLGLKHSENV  600
PKMSRLSIRD FEAYRIKG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_A1e-16436494563Homeobox protein Meis2
3k2a_B1e-16436494563Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011083914.10.0PREDICTED: BEL1-like homeodomain protein 4
SwissprotQ94KL51e-126BLH4_ARATH; BEL1-like homeodomain protein 4
TrEMBLK4BV620.0K4BV62_SOLLC; Uncharacterized protein
STRINGSolyc04g079830.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA60721721
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G23760.31e-116BEL1-like homeodomain 4