PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011083484.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family BBR-BPC
Protein Properties Length: 323aa    MW: 36395.3 Da    PI: 9.9998
Description BBR-BPC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011083484.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GAGA_bind384.41.8e-11713231301
       GAGA_bind   1 mdddgsre..rnkgyye....pa.aslkenlglqlmssiaerdakirernlalsekkaavaerdmaflqrdkalaernkalverdnkllalllve 88 
                     mdd+g+re  r+k  +     ++ +s      +q+m+++aerda+i+ernla+sekkaa+aerdma lqrd+a+aern+a++erdn++++l+++e
  XP_011083484.1   1 MDDSGHREngRHKQPHSqwlmQHqPS-----MKQIMAIMAERDAAIQERNLAISEKKAALAERDMAILQRDSAIAERNNAIMERDNAIATLQFRE 90 
                     99999987677766444222222233.....45************************************************************** PP

       GAGA_bind  89 nsla....salpvgvqvlsgtksidslqqlse...pqledsavelreeeklealpieeaaeeakekkkkkkrqrakkpkekkakkkkkksekskk 176
                     n+++    s +p+g+q+ +g+k+i++ qq+ +   +++ + ++++r++++ ++ p++  a+e  ++++ k++++ak +     +++++k++ks k
  XP_011083484.1  91 NAMNnsntSPCPPGCQIPHGVKHIHHPQQHAHhhqSHMVEAQYNTRDMHMADTVPTSPVAPEPAKARRAKRTKEAKPA-----TAPTRKPSKSLK 180
                     *9998888889*****************94444678999**********99999987776666665555533333322.....233333344444 PP

       GAGA_bind 177 kvkkesader..................skaekksidlvlngvslDestlPvPvCsCtGalrqCYkWGnGGWqSaCCtttiSvyPLPvstkrrga 253
                     kvk+e++d +                  +k+++k++dl+ln+v++De+t+PvPvCsCtG+lr CYkWGnGGWqS+CCtt++S+yPLP+++++r+a
  XP_011083484.1 181 KVKREGEDLNktmfekphewtngpdmsrTKQDWKDQDLGLNQVAFDETTMPVPVCSCTGVLRPCYKWGNGGWQSSCCTTNLSMYPLPAVPNKRHA 275
                     4444444422245555678899999999******************************************************************* PP

       GAGA_bind 254 RiagrKmSqgafkklLekLaaeGydlsnpvDLkdhWAkHGtnkfvtir 301
                     R++grKmS++af+kl+++LaaeG+dlsnpvDLkdhWAkHGtn+++ti+
  XP_011083484.1 276 RVGGRKMSGSAFNKLISRLAAEGHDLSNPVDLKDHWAKHGTNRYITIK 323
                     ***********************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012265.9E-1621323IPR010409GAGA-binding transcriptional activator
PfamPF062174.4E-1061323IPR010409GAGA-binding transcriptional activator
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009723Biological Processresponse to ethylene
GO:0005730Cellular Componentnucleolus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 323 aa     Download sequence    Send to blast
MDDSGHRENG RHKQPHSQWL MQHQPSMKQI MAIMAERDAA IQERNLAISE KKAALAERDM  60
AILQRDSAIA ERNNAIMERD NAIATLQFRE NAMNNSNTSP CPPGCQIPHG VKHIHHPQQH  120
AHHHQSHMVE AQYNTRDMHM ADTVPTSPVA PEPAKARRAK RTKEAKPATA PTRKPSKSLK  180
KVKREGEDLN KTMFEKPHEW TNGPDMSRTK QDWKDQDLGL NQVAFDETTM PVPVCSCTGV  240
LRPCYKWGNG GWQSSCCTTN LSMYPLPAVP NKRHARVGGR KMSGSAFNKL ISRLAAEGHD  300
LSNPVDLKDH WAKHGTNRYI TIK
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00540DAPTransfer from AT5G42520Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011083494.10.0PREDICTED: protein BASIC PENTACYSTEINE6
RefseqXP_011083493.10.0PREDICTED: protein BASIC PENTACYSTEINE6
RefseqXP_011083492.10.0PREDICTED: protein BASIC PENTACYSTEINE6
RefseqXP_011083491.10.0PREDICTED: protein BASIC PENTACYSTEINE6
RefseqXP_011083490.10.0PREDICTED: protein BASIC PENTACYSTEINE6
RefseqXP_011083489.10.0PREDICTED: protein BASIC PENTACYSTEINE6
RefseqXP_011083488.10.0PREDICTED: protein BASIC PENTACYSTEINE6
RefseqXP_011083487.10.0PREDICTED: protein BASIC PENTACYSTEINE6
RefseqXP_011083486.10.0PREDICTED: protein BASIC PENTACYSTEINE6
RefseqXP_011083485.10.0PREDICTED: protein BASIC PENTACYSTEINE6
RefseqXP_011083484.10.0PREDICTED: protein BASIC PENTACYSTEINE6
SwissprotQ8L9991e-152BPC6_ARATH; Protein BASIC PENTACYSTEINE6
TrEMBLA0A0L9V9700.0A0A0L9V970_PHAAN; Uncharacterized protein
TrEMBLA0A0S3RAS60.0A0A0S3RAS6_PHAAN; Uncharacterized protein
STRINGGLYMA04G02860.11e-179(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA53532338
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G42520.11e-145basic pentacysteine 6