PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011083223.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family BBR-BPC
Protein Properties Length: 310aa    MW: 33978.5 Da    PI: 10.1243
Description BBR-BPC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011083223.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GAGA_bind319.69.8e-9813101301
       GAGA_bind   1 mdddgsre.rnkgyyepa.aslkenlglqlmssiaerdaki..........rernlalsekkaavaerd.....maflqrdkalaernkalverd 78 
                     md +g+++ rn+g+ ep  ++lk++lglqlmss+ae+              + + +  s++ ++++++      +a+   d ++++        +
  XP_011083223.1   1 MDGNGNMNlRNWGFLEPPtTTLKSHLGLQLMSSMAEKPLFGgggvrdhqhtHPSSVMASTNGGPFHHHRvggisEAHFPMDYWMNQ-------NR 88 
                     999*************9989**************987654477665544444444433444445555558999966669999****.......55 PP

       GAGA_bind  79 nkllalllvenslasalpvgvqvlsgtksidslqqlsepqledsavelreeeklealpieeaaeeakekkkkkkrqrakkpkek.kakkkkkkse 172
                     +k+l++l  ++       ++++v+++t+s++s+q+ ++ +l ++   + e+e++ ++  +      +  +  kkr  +k+pk++ k+kk++ +++
  XP_011083223.1  89 DKYLNVLSGNQH-HAYYQSSYGVSPETSSAHSIQMPQQMNLPKNDNVICEMEEVCEERDNGGGGGGSGGAVAKKRGGGKVPKSPpKEKKPRTRTP 182
                     677777764444.44555789**************888888888888888887766665666666677777888889999999725568888888 PP

       GAGA_bind 173 kskkkvkkesaderskaekksidlvlngvslDestlPvPvCsCtGalrqCYkWGnGGWqSaCCtttiSvyPLPvstkrrgaRiagrKmSqgafkk 267
                       +++++++s+ +r++++kk  ++v+ngvs+D+s +P+PvCsCtG+++qCY+WG+GGWqSaCCtt +SvyPLP+s+krrgaRiagrKmS gafkk
  XP_011083223.1 183 RVQRDESAPSV-HRARTPKKRAEIVINGVSMDISEIPIPVCSCTGTPQQCYRWGSGGWQSACCTTGVSVYPLPMSSKRRGARIAGRKMSIGAFKK 276
                     88888888887.6********************************************************************************** PP

       GAGA_bind 268 lLekLaaeGydlsnpvDLkdhWAkHGtnkfvtir 301
                     +LekLa+eGy++snp+DL+++WAkHGtnkfvtir
  XP_011083223.1 277 VLEKLASEGYNFSNPIDLRSYWAKHGTNKFVTIR 310
                     *********************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012262.2E-1311310IPR010409GAGA-binding transcriptional activator
PfamPF062172.2E-991310IPR010409GAGA-binding transcriptional activator
Sequence ? help Back to Top
Protein Sequence    Length: 310 aa     Download sequence    Send to blast
MDGNGNMNLR NWGFLEPPTT TLKSHLGLQL MSSMAEKPLF GGGGVRDHQH THPSSVMAST  60
NGGPFHHHRV GGISEAHFPM DYWMNQNRDK YLNVLSGNQH HAYYQSSYGV SPETSSAHSI  120
QMPQQMNLPK NDNVICEMEE VCEERDNGGG GGGSGGAVAK KRGGGKVPKS PPKEKKPRTR  180
TPRVQRDESA PSVHRARTPK KRAEIVINGV SMDISEIPIP VCSCTGTPQQ CYRWGSGGWQ  240
SACCTTGVSV YPLPMSSKRR GARIAGRKMS IGAFKKVLEK LASEGYNFSN PIDLRSYWAK  300
HGTNKFVTIR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ0469473e-58KJ046947.1 Sesamum indicum clone TilSSR_18148 microsatellite Sesame_18148 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011083223.10.0PREDICTED: protein BASIC PENTACYSTEINE2-like
TrEMBLH1ZN721e-142H1ZN72_TRIPD; GAGA-binding transcriptional activator
STRINGGLYMA09G30040.41e-125(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA100482026
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14685.31e-81basic pentacysteine 2