PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011082709.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family HD-ZIP
Protein Properties Length: 203aa    MW: 22345.4 Da    PI: 8.0293
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011082709.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox53.63.8e-172174457
                    -SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
        Homeobox  4 RttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57
                    + +++++q++ Le+ F   +++  e++ +LA++lg++ rq+ +W+qN+Ra++k+
  XP_011082709.1 21 KKRLSQDQVQLLEASFDAAKKLEPERKFQLARELGVPPRQIAIWYQNKRARWKN 74
                    56799***********************************************95 PP

2HD-ZIP_I/II108.83.9e-3520111293
     HD-ZIP_I/II   2 kkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelke 93 
                     +k+rls++qv+lLE sF++ +kLeperK +lareLg+ prq+a+W+qn+RAR+k++ lE dy aL+ +++a  +++++Lekev++Lr elk+
  XP_011082709.1  20 QKKRLSQDQVQLLEASFDAAKKLEPERKFQLARELGVPPRQIAIWYQNKRARWKNQSLELDYGALQVRLEAALADKKQLEKEVDSLRGELKR 111
                     69*************************************************************************************99986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007116.0661575IPR001356Homeobox domain
SuperFamilySSF466898.17E-171783IPR009057Homeodomain-like
SMARTSM003893.5E-141779IPR001356Homeobox domain
CDDcd000863.59E-142176No hitNo description
PfamPF000461.6E-142174IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.604.3E-182281IPR009057Homeodomain-like
PROSITE patternPS0002705073IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009637Biological Processresponse to blue light
GO:0009646Biological Processresponse to absence of light
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 203 aa     Download sequence    Send to blast
MMQIGKKTMS LSPSSQSKLQ KKRLSQDQVQ LLEASFDAAK KLEPERKFQL ARELGVPPRQ  60
IAIWYQNKRA RWKNQSLELD YGALQVRLEA ALADKKQLEK EVDSLRGELK RAHAMLFGLR  120
QAQAQAQAQA CVSAPPGSCL SSCCDEGAGS SPNEDVGCSA TWQNGDALQF EELYACLMLG  180
AGRGSNSCGP IIPDGVNERD FWV
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011082709.11e-148PREDICTED: homeobox-leucine zipper protein ATHB-52
TrEMBLA0A022RY581e-85A0A022RY58_ERYGU; Uncharacterized protein
STRINGPOPTR_0011s11510.11e-54(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA27152453
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G53980.14e-30homeobox protein 52