PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011082627.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family GRAS
Protein Properties Length: 601aa    MW: 67759.2 Da    PI: 5.2226
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011082627.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS287.92.9e-882315991374
            GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalkl...fsevsPilk 92 
                     lv+lLl++Ae v+++ +ela++++ r   +as +g+p+qR+a+yf+eAL+++++r++ ++ +  + ++ ++++   +l   ++    ++  P+++
  XP_011082627.1 231 LVNLLLAAAENVATQRFELATKFVVRCLWMASDSGTPVQRIAFYFAEALQEKINRESGRIINEKKKQPGKQQKLGLALGTNNTflaSHQELPFIQ 325
                     689****************************************************999999988888888888666666666622235678**** PP

            GRAS  93 fshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrle 187
                     + +++  q+I+e v+++ ++H iD++i  G+QW aL+q La+  ++  +l+iT+vg    g+++ +eetg+rL  fA++l++pf+f+ ++ ++++
  XP_011082627.1 326 VMQFAGMQTIVEHVKTAGKIHLIDLQIRSGIQWTALMQGLAD--SPIQHLKITAVGT---GDQRYVEETGNRLLCFAQSLNLPFSFKSVYLTDMK 415
                     *****************************************9..6777*********...89********************************* PP

            GRAS 188 dleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseer 282
                     +++ + L+++ +E+++V + + l ++ + + +le+    +++++ +l+P+++vv+e ea+hns+sF++rf+ea+ +ysa+fd+le  + r++++r
  XP_011082627.1 416 AFKEDLLNIEADETVVVYSNIILRSMISMPDCLEN----LMRTITRLKPTLMVVTEVEANHNSPSFVDRFMEAFLFYSAFFDCLEDCMDRNNKHR 506
                     *********************99999966666666....******************************************************** PP

            GRAS 283 ikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgslvlgWkdrpLvsvSaWr 374
                     + +E  +lg+ i n+va  g+er+ r  +l  Wr+ ++++G+ +++ls++   qa+l l++++ ++  ++e++ + l+ gWk+ pL s++aW+
  XP_011082627.1 507 TILESTYLGKGILNIVADDGQERFTRSVKLDVWRAFFMRFGMIEIELSDSSRYQASLTLKQFAqGNSCTLESNGKGLTVGWKGTPLHSLTAWK 599
                     ***************************************************************888899***********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098542.679205578IPR005202Transcription factor GRAS
PfamPF035141.0E-85231599IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 601 aa     Download sequence    Send to blast
MILDHSTRER SASMENAYLF PSFQFCDYDP VVVGYARDEA ASRSRISTIT KEDPFLEMDE  60
SGFMDLFSSL FGQENTQQDV ERKGDDQLIM IGGVPQTVSA SGCSMLKQIE TETNLIEARK  120
HEDIQPPPAV SEFSRHLKNN PVSVFPPPAS WDLLNNYGKG FRMSRDENLN CLENESDVGG  180
RRLSMDEILR VGGERFIQFS TKSVDGISMF IHPYASSLSG LSMDDARDVE LVNLLLAAAE  240
NVATQRFELA TKFVVRCLWM ASDSGTPVQR IAFYFAEALQ EKINRESGRI INEKKKQPGK  300
QQKLGLALGT NNTFLASHQE LPFIQVMQFA GMQTIVEHVK TAGKIHLIDL QIRSGIQWTA  360
LMQGLADSPI QHLKITAVGT GDQRYVEETG NRLLCFAQSL NLPFSFKSVY LTDMKAFKED  420
LLNIEADETV VVYSNIILRS MISMPDCLEN LMRTITRLKP TLMVVTEVEA NHNSPSFVDR  480
FMEAFLFYSA FFDCLEDCMD RNNKHRTILE STYLGKGILN IVADDGQERF TRSVKLDVWR  540
AFFMRFGMIE IELSDSSRYQ ASLTLKQFAQ GNSCTLESNG KGLTVGWKGT PLHSLTAWKF  600
S
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_A2e-3723959827378Protein SCARECROW
5b3h_A2e-3723959826377Protein SCARECROW
5b3h_D2e-3723959826377Protein SCARECROW
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_011082627.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011082627.10.0DELLA protein RGL1-like
TrEMBLA0A2G9HDJ70.0A0A2G9HDJ7_9LAMI; Uncharacterized protein
STRINGMigut.N00927.1.p0.0(Erythranthe guttata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA46941842
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G03450.14e-53RGA-like 2