PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011082019.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family CO-like
Protein Properties Length: 339aa    MW: 37206.5 Da    PI: 5.1595
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011082019.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box216.9e-071244436
        zf-B_box  4 rkCpeHeekelqlfCedCqqllCedClleeHkg 36
                    + C+ ++   ++ fC+ ++ +lC  C  + H  
  XP_011082019.1 12 KLCDSCKTASATVFCRADSAFLCLACDAKVHAA 44
                    68*************************999954 PP

2zf-B_box27.18.5e-095498341
        zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htvvp 41
                     ++C+ +e+ +++  C+ +   lC++C   +H+       H++ p
  XP_011082019.1 54 VWVCEVCEQAPASVTCKADAAALCATCDRDIHSAnplarrHERLP 98
                    689*****************************6688888898877 PP

3CCT70.15.6e-24276320145
             CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqae 45 
                     Rea++lRY+eKrk+RkFeK+irY+sRKa+Ae+RpR+KGrF+k++e
  XP_011082019.1 276 REARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRSE 320
                     9*****************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003361.4E-11956IPR000315B-box-type zinc finger
PROSITE profilePS5011910.48956IPR000315B-box-type zinc finger
PfamPF006439.2E-61251IPR000315B-box-type zinc finger
CDDcd000211.51E-81356No hitNo description
PROSITE profilePS5011910.7935299IPR000315B-box-type zinc finger
PfamPF006437.1E-75499IPR000315B-box-type zinc finger
CDDcd000211.09E-85599No hitNo description
SMARTSM003365.5E-105799IPR000315B-box-type zinc finger
PfamPF062034.9E-18276318IPR010402CCT domain
PROSITE profilePS5101716.787276318IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 339 aa     Download sequence    Send to blast
MGGDQTWSLT AKLCDSCKTA SATVFCRADS AFLCLACDAK VHAANKLASR HARVWVCEVC  60
EQAPASVTCK ADAAALCATC DRDIHSANPL ARRHERLPVV PFYDAASATK SSPSASAAEE  120
FSEEEAEAAS WLLPDPNSKS EEESESPEYK SAEYLFSDMD PYLDLELISG EQKPHHVVIN  180
EQKQYSSDGV VPVQNKNEYG SGQYPGPVVD GFPTYEVDYP GTKPFMYNFT TQSISQSVSS  240
SSLDVGVVPD HNAMADVSDT LAKTDAVPIP VSGMDREARV LRYREKRKNR KFEKTIRYAS  300
RKAYAETRPR IKGRFAKRSE LEIDSLIAPD ASYGVVPSF
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_011082019.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011082019.10.0zinc finger protein CONSTANS-LIKE 4-like
SwissprotQ940T91e-102COL4_ARATH; Zinc finger protein CONSTANS-LIKE 4
TrEMBLA0A2G9FY220.0A0A2G9FY22_9LAMI; GATA-4/5/6 transcription factor
STRINGXP_009590370.11e-172(Nicotiana tomentosiformis)
STRINGXP_009618115.11e-172(Nicotiana tomentosiformis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA10352376
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G24930.13e-92CONSTANS-like 4