PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011081287.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family MYB_related
Protein Properties Length: 342aa    MW: 36584.6 Da    PI: 7.1881
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011081287.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding39.11.8e-12108152347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE+  ++ + ++lG+g+W+ Iar +   Rt+ q+ s+ qky
   XP_011081287.1 108 PWTEEEHRMFLLGLQKLGKGDWRGIARNFVISRTPTQVASHAQKY 152
                      8*****************************99************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.60.107.0E-4321IPR001878Zinc finger, CCHC-type
PROSITE profilePS5129419.925101157IPR017930Myb domain
SuperFamilySSF466896.46E-17103158IPR009057Homeodomain-like
TIGRFAMsTIGR015573.0E-19104156IPR006447Myb domain, plants
SMARTSM007173.9E-11105155IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.4E-12105151IPR009057Homeodomain-like
PfamPF002498.3E-11108152IPR001005SANT/Myb domain
CDDcd001672.03E-9108153No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000122Biological Processnegative regulation of transcription from RNA polymerase II promoter
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0030307Biological Processpositive regulation of cell growth
GO:0046686Biological Processresponse to cadmium ion
GO:0048366Biological Processleaf development
GO:2000469Biological Processnegative regulation of peroxidase activity
GO:0000976Molecular Functiontranscription regulatory region sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 342 aa     Download sequence    Send to blast
MTRRCSHCSH NGHNSRTCPN RGVKLFGVRL TDGSIRKSAS MGNLTHYMGG GGGGSGSGSA  60
TPQNGVTHDS PADTPDHPSA GSGGADGYAS EDFVAGSSSS RERKKGVPWT EEEHRMFLLG  120
LQKLGKGDWR GIARNFVISR TPTQVASHAQ KYFIRQSNVS RRKRRSSLFD IVADDSVDTP  180
VVSREFFPVN PSQAETQSST PVPPPAVDEE CESMESATSN DGENMLPKPE GSQYTYPVVY  240
PAYVAPFFTL PIPFWPGYKT EPVKEETHEV VKPTAVHSKS PINVDELVGM SKLSLGESLA  300
DAGPSTLSLK LVEGSTRPSA FHANPASGSS GMNSSHDPIH AV
Functional Description ? help Back to Top
Source Description
UniProtTranscription repressor that binds to 5'-TATCCA-3' elements in gene promoters. Contributes to the sugar-repressed transcription of promoters containing SRS or 5'-TATCCA-3' elements. Transcription repressor involved in a cold stress response pathway that confers cold tolerance. Suppresses the DREB1-dependent signaling pathway under prolonged cold stress. DREB1 responds quickly and transiently while MYBS3 responds slowly to cold stress. They may act sequentially and complementarily for adaptation to short- and long-term cold stress (PubMed:20130099). {ECO:0000269|PubMed:12172034, ECO:0000269|PubMed:20130099}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00551DAPTransfer from AT5G47390Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_011081287.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Repressed by sucrose and gibberellic acid (GA) (PubMed:12172034). Induced by cold stress in roots and shoots. Induced by salt stress in shoots. Down-regulated by abscisic aci (ABA) in shoots (PubMed:20130099). {ECO:0000269|PubMed:12172034, ECO:0000269|PubMed:20130099}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ0384802e-56KJ038480.1 Sesamum indicum clone TilSSR_9681 microsatellite sesame_9681 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011081287.10.0transcription factor MYBS3
SwissprotQ7XC571e-134MYBS3_ORYSJ; Transcription factor MYBS3
TrEMBLA0A2G9H7590.0A0A2G9H759_9LAMI; Uncharacterized protein
TrEMBLA0A4D9A7W60.0A0A4D9A7W6_SALSN; Uncharacterized protein
STRINGMigut.A01139.1.p0.0(Erythranthe guttata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA70622431
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G47390.11e-119MYB_related family protein
Publications ? help Back to Top
  1. Rice Chromosome 10 Sequencing Consortium
    In-depth view of structure, activity, and evolution of rice chromosome 10.
    Science, 2003. 300(5625): p. 1566-9
    [PMID:12791992]
  2. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  3. Su CF, et al.
    A novel MYBS3-dependent pathway confers cold tolerance in rice.
    Plant Physiol., 2010. 153(1): p. 145-58
    [PMID:20130099]