PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011080777.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family LBD
Protein Properties Length: 170aa    MW: 18675.4 Da    PI: 7.7342
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011080777.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260143.18.4e-4571061100
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     +Ca+Ck+lrr+CakdC++apyfp ++p+kfa+vhk+FGasnv+k+l++lp ++r da++slvyeA+ar+rdPvyG+vg i+ lq+q++ql+ +la
  XP_011080777.1   7 PCASCKLLRRRCAKDCIFAPYFPPDDPHKFAIVHKVFGASNVSKMLQELPVHQRGDAVNSLVYEANARMRDPVYGCVGAISYLQNQVSQLQMQLA 101
                     7********************************************************************************************** PP

          DUF260  96 llkee 100
                     ++++e
  XP_011080777.1 102 VAQAE 106
                     *9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.8996107IPR004883Lateral organ boundaries, LOB
PfamPF031952.5E-447104IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009965Biological Processleaf morphogenesis
Sequence ? help Back to Top
Protein Sequence    Length: 170 aa     Download sequence    Send to blast
MGGGSSPCAS CKLLRRRCAK DCIFAPYFPP DDPHKFAIVH KVFGASNVSK MLQELPVHQR  60
GDAVNSLVYE ANARMRDPVY GCVGAISYLQ NQVSQLQMQL AVAQAEILCI QMQQEQSPAA  120
MVGLPPPPQD EKSSLLLATN NFNNLQQCFG FASTSSNVMQ DPLKRESLWT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A4e-4931087112LOB family transfactor Ramosa2.1
5ly0_B4e-4931087112LOB family transfactor Ramosa2.1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_011080777.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011080777.11e-125LOB domain-containing protein 12
SwissprotQ8LBW36e-81LBD12_ARATH; LOB domain-containing protein 12
TrEMBLA0A2G9I6Q41e-100A0A2G9I6Q4_9LAMI; Uncharacterized protein
STRINGVIT_06s0004g07200.t014e-94(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA4324669
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30130.13e-83LBD family protein
Publications ? help Back to Top
  1. Penfield S, et al.
    Reserve mobilization in the Arabidopsis endosperm fuels hypocotyl elongation in the dark, is independent of abscisic acid, and requires PHOSPHOENOLPYRUVATE CARBOXYKINASE1.
    Plant Cell, 2004. 16(10): p. 2705-18
    [PMID:15367715]