PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011080351.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family NF-YA
Protein Properties Length: 316aa    MW: 34656.2 Da    PI: 9.5032
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011080351.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA103.42.1e-32166222158
       CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                     +ep+YVNaKQy++Il+RRq+Rak+e ekkl +k rkpylheSRh+hAlrR+Rg+gGrF
  XP_011080351.1 166 QEPVYVNAKQYHGILRRRQSRAKAELEKKL-IKVRKPYLHESRHQHALRRARGTGGRF 222
                     69****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005211.1E-35164225IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115237.117165225IPR001289Nuclear transcription factor Y subunit A
PfamPF020452.5E-27167222IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006161.8E-24168190IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS006860170190IPR018362CCAAT-binding factor, conserved site
PRINTSPR006161.8E-24199222IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 316 aa     Download sequence    Send to blast
MQSKSKSVHQ GEAAGLYNVA NSTSDPWWNN TGYNSFSPAM MRGNASDSSS LEQSVDGQSQ  60
SEGGINEEDD DTTKKSPTGT PLQPDRRYGR EGPKLQQVPP TLHPRNDGNF THAPQLELVG  120
HSVACGSNPY DQYYGGMMAA YAQSLVPPYL HDMHHARMPL PLEMAQEPVY VNAKQYHGIL  180
RRRQSRAKAE LEKKLIKVRK PYLHESRHQH ALRRARGTGG RFAKKSDSDT SKGTDSGSAI  240
MSQSISSSGS GPFLSDSSGA KVPDAQDLYN SDIGNFRNQT NWQVQANQRR SAETGEGPTS  300
SQKWGNIPPN RALAMP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A2e-21166240276NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011080352.10.0PREDICTED: nuclear transcription factor Y subunit A-1-like isoform X2
RefseqXP_011080351.10.0PREDICTED: nuclear transcription factor Y subunit A-1-like isoform X2
RefseqXP_011080350.10.0PREDICTED: nuclear transcription factor Y subunit A-1-like isoform X2
RefseqXP_011080349.10.0PREDICTED: nuclear transcription factor Y subunit A-1-like isoform X2
RefseqXP_011080348.10.0PREDICTED: nuclear transcription factor Y subunit A-1-like isoform X2
RefseqXP_011080347.10.0PREDICTED: nuclear transcription factor Y subunit A-1-like isoform X2
RefseqXP_011080346.10.0PREDICTED: nuclear transcription factor Y subunit A-1-like isoform X2
RefseqXP_011080345.10.0PREDICTED: nuclear transcription factor Y subunit A-1-like isoform X2
SwissprotQ9LXV55e-56NFYA1_ARATH; Nuclear transcription factor Y subunit A-1
TrEMBLA5PGU31e-154A5PGU3_ANTMA; YA4
STRINGPGSC0003DMT4000277851e-112(Solanum tuberosum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G12840.31e-53nuclear factor Y, subunit A1