PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011080062.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family NAC
Protein Properties Length: 290aa    MW: 33064.8 Da    PI: 6.5544
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011080062.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM163.29.9e-51101381129
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 
                     lppGfrF P+d+elv++yL kk+++++++   ++ e+d++++ePw+Lp  +k +++ewyfFs rd+kyatg r+nrat+sgyWkatgkd++vl+ 
  XP_011080062.1  10 LPPGFRFYPSDDELVCHYLYKKIANEQVHR-GTLVEIDLHTCEPWQLPDVAKLNSNEWYFFSFRDRKYATGFRTNRATTSGYWKATGKDRAVLDP 103
                     79*************************999.78***************87778899**************************************9 PP

             NAM  96 .kgelvglkktLvfykgrapkgektdWvmheyrle 129
                      ++++vg++ktLvfyk+rap+g kt W+mhe+rle
  XP_011080062.1 104 rSRAVVGMRKTLVFYKNRAPNGIKTGWIMHEFRLE 138
                     56677***************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019415.36E-619156IPR003441NAC domain
PROSITE profilePS5100557.67610156IPR003441NAC domain
PfamPF023652.1E-2711137IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 290 aa     Download sequence    Send to blast
MGLREIGETL PPGFRFYPSD DELVCHYLYK KIANEQVHRG TLVEIDLHTC EPWQLPDVAK  60
LNSNEWYFFS FRDRKYATGF RTNRATTSGY WKATGKDRAV LDPRSRAVVG MRKTLVFYKN  120
RAPNGIKTGW IMHEFRLENP NVPPKEDWVL CRVFHKSRSS SSSDHHHHQN SKESSIIPHS  180
TDLYADSTAV ATSPNLAASP TNNDIQHAYQ NIITSFFHTQ NPSTSLGLTS SPLDHPAAYL  240
HDCMQPAQNR MVLEAKCEDD YGFLFDFDAS NGVPSSLEDM GFDDDHHHDM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-4811604169NO APICAL MERISTEM PROTEIN
1ut4_B2e-4811604169NO APICAL MERISTEM PROTEIN
1ut7_A2e-4811604169NO APICAL MERISTEM PROTEIN
1ut7_B2e-4811604169NO APICAL MERISTEM PROTEIN
3swm_A2e-4811607172NAC domain-containing protein 19
3swm_B2e-4811607172NAC domain-containing protein 19
3swm_C2e-4811607172NAC domain-containing protein 19
3swm_D2e-4811607172NAC domain-containing protein 19
3swp_A2e-4811607172NAC domain-containing protein 19
3swp_B2e-4811607172NAC domain-containing protein 19
3swp_C2e-4811607172NAC domain-containing protein 19
3swp_D2e-4811607172NAC domain-containing protein 19
4dul_A2e-4811604169NAC domain-containing protein 19
4dul_B2e-4811604169NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that mediates auxin signaling to promote lateral root development. Activates the expression of two downstream auxin-responsive genes, DBP and AIR3. {ECO:0000269|PubMed:11114891}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_011080062.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by auxin.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ0473522e-56KJ047352.1 Sesamum indicum clone TilSSR_18553 microsatellite Sesame_18553 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011080062.10.0protein CUP-SHAPED COTYLEDON 3
SwissprotQ84TE63e-61NAC22_ARATH; NAC domain-containing protein 21/22
TrEMBLA0A2G9HEI91e-142A0A2G9HEI9_9LAMI; Uncharacterized protein
STRINGMigut.D00437.1.p1e-117(Erythranthe guttata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA18822466
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G28530.15e-90NAC domain containing protein 74
Publications ? help Back to Top
  1. Le Hénanff G, et al.
    Grapevine NAC1 transcription factor as a convergent node in developmental processes, abiotic stresses, and necrotrophic/biotrophic pathogen tolerance.
    J. Exp. Bot., 2013. 64(16): p. 4877-93
    [PMID:24043850]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Xiao D, et al.
    SENESCENCE-SUPPRESSED PROTEIN PHOSPHATASE Directly Interacts with the Cytoplasmic Domain of SENESCENCE-ASSOCIATED RECEPTOR-LIKE KINASE and Negatively Regulates Leaf Senescence in Arabidopsis.
    Plant Physiol., 2015. 169(2): p. 1275-91
    [PMID:26304848]
  4. Huo X,Wang C,Teng Y,Liu X
    Identification of miRNAs associated with dark-induced senescence in Arabidopsis.
    BMC Plant Biol., 2015. 15: p. 266
    [PMID:26530097]
  5. Chen X, et al.
    Auxin-Independent NAC Pathway Acts in Response to Explant-Specific Wounding and Promotes Root Tip Emergence during de Novo Root Organogenesis in Arabidopsis.
    Plant Physiol., 2016. 170(4): p. 2136-45
    [PMID:26850273]
  6. Liu C,Wang B,Li Z,Peng Z,Zhang J
    TsNAC1 Is a Key Transcription Factor in Abiotic Stress Resistance and Growth.
    Plant Physiol., 2018. 176(1): p. 742-756
    [PMID:29122985]