PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011079319.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family CO-like
Protein Properties Length: 368aa    MW: 39884.4 Da    PI: 6.6631
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011079319.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box18.64e-062664439
        zf-B_box  4 rkCpeHeekelqlfCedCqqllCedClleeHkg...Htv 39
                    + C+ +++  + lfC+  + ++C  C ++ H +   H++
  XP_011079319.1 26 KPCDYCSSAAALLFCHAHSAFMCMACDSKVHASddkHER 64
                    68*******9*********************87888876 PP

2zf-B_box23.41.2e-0765109341
        zf-B_box   3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htvvp 41 
                      ++C+ +e+ ++   C+ +   lC +C   +H+       H++v 
  XP_011079319.1  65 VWMCEVCEHAPAAVTCKADAAALCVSCDRDIHSAnplarrHERVA 109
                     689*****************************6688888898875 PP

3CCT71.61.9e-24296339144
             CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                     Rea++lRYkeKrk+RkF+K+irY+sRKa+Ae+RpR+KGrF+k++
  XP_011079319.1 296 REARVLRYKEKRKNRKFDKTIRYASRKAYAETRPRIKGRFAKRT 339
                     9*****************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003360.672356IPR000315B-box-type zinc finger
PROSITE profilePS501199.2432367IPR000315B-box-type zinc finger
CDDcd000212.31E-72767No hitNo description
PROSITE profilePS5011910.22463110IPR000315B-box-type zinc finger
SMARTSM003361.5E-1463110IPR000315B-box-type zinc finger
PfamPF006438.6E-665109IPR000315B-box-type zinc finger
CDDcd000211.61E-866108No hitNo description
PROSITE profilePS5101716.658296338IPR010402CCT domain
PfamPF062031.7E-18296338IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 368 aa     Download sequence    Send to blast
MGISHDGAGV ARPPKSFTPG WNVAAKPCDY CSSAAALLFC HAHSAFMCMA CDSKVHASDD  60
KHERVWMCEV CEHAPAAVTC KADAAALCVS CDRDIHSANP LARRHERVAV VPFYETAESM  120
LMTSSGAANL SVPVSGSASD MFAAPPSDGD SWASTNPIFA TKLPADTPVD VKSLEFFFSD  180
SDQFLDFDNY QISSQTYGGD SVVPVQTTIK PSVPVQSTHQ FSPENRFEID FTRSRIASYN  240
SNYTTPSLSH SVSSSSMDVG IVPEGSSMSE ISSRTMSTSS FDLSANPAPQ PAGLDREARV  300
LRYKEKRKNR KFDKTIRYAS RKAYAETRPR IKGRFAKRTD SESDIDGIFS SGGGSFFGDA  360
RYGVVPSF
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_011079319.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011079319.10.0zinc finger protein CONSTANS-LIKE 5-like
TrEMBLA0A2G9HFV01e-175A0A2G9HFV0_9LAMI; GATA-4/5/6 transcription factor
STRINGMigut.K00262.1.p1e-147(Erythranthe guttata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA10352376
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G57660.19e-86CONSTANS-like 5