PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011078988.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family CO-like
Protein Properties Length: 335aa    MW: 36754 Da    PI: 5.3062
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011078988.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box21.83.9e-071143436
        zf-B_box  4 rkCpeHeekelqlfCedCqqllCedClleeHkg 36
                    + C+ ++  +++ fC+ ++ +lC  C ++ H  
  XP_011078988.1 11 KLCDSCKTAPATVFCRADSAFLCLPCDSKVHAA 43
                    68**************************99954 PP

2zf-B_box279e-095398342
        zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htvvpl 42
                     ++C+ +e+ ++   C+ +   lC++C   +H+       H++ p+
  XP_011078988.1 53 VWVCEVCEQAPAAVTCKADAAALCPTCDRDIHSAnplarrHERLPI 98
                    689*****************************66888888998876 PP

3CCT70.15.6e-24272316145
             CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqae 45 
                     Rea++lRY+eKrk+RkFeK+irY+sRKa+Ae+RpR+KGrF+k++e
  XP_011078988.1 272 REARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRSE 316
                     9*****************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003369.4E-13855IPR000315B-box-type zinc finger
PROSITE profilePS5011910.438855IPR000315B-box-type zinc finger
PfamPF006434.6E-61150IPR000315B-box-type zinc finger
CDDcd000211.59E-91255No hitNo description
PROSITE profilePS5011910.585198IPR000315B-box-type zinc finger
PfamPF006438.3E-75398IPR000315B-box-type zinc finger
CDDcd000213.16E-85498No hitNo description
SMARTSM003363.5E-95698IPR000315B-box-type zinc finger
PROSITE profilePS5101716.787272314IPR010402CCT domain
PfamPF062034.9E-18272314IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 335 aa     Download sequence    Send to blast
MGGESWSLTA KLCDSCKTAP ATVFCRADSA FLCLPCDSKV HAANKLASRH ARVWVCEVCE  60
QAPAAVTCKA DAAALCPTCD RDIHSANPLA RRHERLPIVP FYDSASATKS SSSAAAAEEV  120
SEEEAEAASW LLPDPNNKLD EDAGSPEYKS AEYLFSDMDP YLDLDLISGE QKPNSHEKKE  180
YSSDRVVPVQ NKNEYGSGQY PGPVVDGFPT YDVDYPGSKP FMYNFTSQSI SQSVSCSSLD  240
VGVVPDHNAM ADVSDTFVKT EAIPTPVSGV DREARVLRYR EKRKNRKFEK TIRYASRKAY  300
AETRPRIKGR FAKRSELEVD SLISGDASYG VVPTF
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_011078988.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011078988.10.0zinc finger protein CONSTANS-LIKE 4-like
SwissprotQ940T91e-102COL4_ARATH; Zinc finger protein CONSTANS-LIKE 4
TrEMBLA0A2G9H9E30.0A0A2G9H9E3_9LAMI; GATA-4/5/6 transcription factor
STRINGPGSC0003DMT4000755201e-167(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA10352376
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G24930.18e-97CONSTANS-like 4