PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011077776.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family bZIP
Protein Properties Length: 197aa    MW: 22686.3 Da    PI: 6.2322
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011077776.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_145.61.5e-1483132554
                     CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
          bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkk 54 
                     +++rr+++NRe+ArrsR RK+  ++eL   v  L +eN+ L+++l++ ++
  XP_011077776.1  83 RKQRRMISNRESARRSRMRKQRHLDELWSQVLRLRTENHNLIDKLNHVSE 132
                     79******************************************999877 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003387.2E-1679143IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.97881144IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1702.7E-1283156No hitNo description
PfamPF001704.8E-1283132IPR004827Basic-leucine zipper domain
SuperFamilySSF579598.13E-1383133No hitNo description
CDDcd147023.55E-2084135No hitNo description
PROSITE patternPS00036086101IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 197 aa     Download sequence    Send to blast
MIPSEIQGMN FFAPENLPAF PANFGLTESS FPALHFSRFS TNLPNYQTSL PGIHEFSPIS  60
MCISSNSTSD EAEDHQLSII DERKQRRMIS NRESARRSRM RKQRHLDELW SQVLRLRTEN  120
HNLIDKLNHV SESHDRVVQE NTRLKEEASD LRQMLTDLQI SNSYGFLRDL EDIPCNTAHL  180
KAESSDQSVT TSTNMLH
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
195102RRSRMRKQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in somatic embryogenesis. Acts as positive regulator of BHLH109. {ECO:0000269|PubMed:26973252}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00647PBMTransfer from LOC_Os02g49560Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_011077776.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011077776.11e-144basic leucine zipper 43
SwissprotQ9FMC28e-41BZP43_ARATH; Basic leucine zipper 43
TrEMBLA0A2G9I8251e-107A0A2G9I825_9LAMI; Uncharacterized protein
STRINGXP_009611005.11e-90(Nicotiana tomentosiformis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA9472492
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G30530.11e-48basic leucine-zipper 42
Publications ? help Back to Top
  1. Nowak K,Gaj MD
    Stress-related function of bHLH109 in somatic embryo induction in Arabidopsis.
    J. Plant Physiol., 2016. 193: p. 119-26
    [PMID:26973252]
  2. Ezer D, et al.
    The G-Box Transcriptional Regulatory Code in Arabidopsis.
    Plant Physiol., 2017. 175(2): p. 628-640
    [PMID:28864470]