PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011077326.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family MYB_related
Protein Properties Length: 779aa    MW: 86290.1 Da    PI: 6.8092
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011077326.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding223.9e-075092347
                     SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     +WT +E+e +  a +q G++ +++I  +++  +   q++++++ +
   XP_011077326.1 50 AWTRQEEESFFAALRQVGKN-FEKITCRVQ-SKNKDQVRHYYYRL 92
                     6*****************99.*********.***********976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.5E-94197IPR009057Homeodomain-like
PROSITE profilePS5129312.0244697IPR017884SANT domain
SMARTSM007171.9E-44795IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.5E-54995IPR009057Homeodomain-like
CDDcd001671.30E-45093No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 779 aa     Download sequence    Send to blast
MVSQVSLDCE LCLGSENLGN KDGGSSVPSF SQEHAAPQMP VKKQTRQWAA WTRQEEESFF  60
AALRQVGKNF EKITCRVQSK NKDQVRHYYY RLVRRMNKLL GPELCLDAKN SKDTNAAMLR  120
WWSLLEKYSC KASKLHLKPR RFKIFVETLE NQLLKDRKKN IKKRLSTGEN NSSIPNIPAG  180
NQVRASGHDN RAVKMVLVDS QNIQKVGTGK GALFKRHINI GMSRTNCKVD PASMKTAKHR  240
RKTGLASTAA YKRWEKAAIA GVSLVADAAE HLERVDTDKE IDNVQETPGH DGSQLVGKVV  300
QSLHASSQSM FNENNIHNSA KLKLQLFPID ECTRKALEMD NHNPHLELTL STRKKLSSIL  360
EHLNRKWGNS SSLSKELMLF PYWAQRENLV GYQKWTKDSP LCAADVYYLI GSPPIFRLRY  420
GWFSKAEVES ATAQALSCAN IKEQNLNINI APEQNAEAEN PNSPLGDQLV SAEKLITLSP  480
SSTRTPITTV ECGVSVSKIN TSRFQDSTAG LSSLREESGD LAVTRQVENM KNIALSTGEW  540
ADSLTNISVG DLLSESTQST DVNCTEFPMP LGSNCFQQMP FSCDSFDAAI AAHIYKHQNK  600
VDLQQGLASH APSIWDGEET CDAFAFQKTG AFCNKEQDVS MNDTMDACKQ ATVPSPSASH  660
EELPEMEKVT SSDLACGDLM DDGMSDHPSE NSTKDFGGLT DIYWPDSLGP LDLDIPSCRY  720
HSNDLILSDS LSGLNRLIAN SVDAFQSCSF FGLDKKEPAS TAEARQTASF SDFKIGSEV
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_011077326.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011077326.10.0TSL-kinase interacting protein 1 isoform X1
SwissprotQ8LJT80.0TKI1_ARATH; TSL-kinase interacting protein 1
TrEMBLA0A2G9H0X90.0A0A2G9H0X9_9LAMI; Polycomb-group transcriptional regulator
STRINGMigut.L01697.1.p0.0(Erythranthe guttata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA86401719
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G36960.20.0TSL-kinase interacting protein 1