PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011077272.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family WOX
Protein Properties Length: 248aa    MW: 28295.2 Da    PI: 8.768
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011077272.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox65.38.3e-212079357
                    --SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
        Homeobox  3 kRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
                    +R+++tkeq++ Le l+++  r+p+ae++++++++l    +++ ++V++WFqN++a++++
  XP_011077272.1 20 SRWNPTKEQINMLEGLYRQgLRTPTAEQIQQITARLrafgHIEGKNVFYWFQNHKARQRQ 79
                    6*****************99**************************************97 PP

2Wus_type_Homeobox113.97.8e-372081465
  Wus_type_Homeobox  4 tRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65
                       +RW+Pt+eQi++Le ly++GlrtP++e+iq+ita+L+++G+ie+kNVfyWFQN+kaR+rqkq
     XP_011077272.1 20 SRWNPTKEQINMLEGLYRQGLRTPTAEQIQQITARLRAFGHIEGKNVFYWFQNHKARQRQKQ 81
                       7***********************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.58E-121387IPR009057Homeodomain-like
SMARTSM003898.9E-51784IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.605.2E-82079IPR009057Homeodomain-like
PfamPF000461.9E-182079IPR001356Homeobox domain
CDDcd000863.75E-62181No hitNo description
PROSITE profilePS5007110.4952580IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008284Biological Processpositive regulation of cell proliferation
GO:0009942Biological Processlongitudinal axis specification
GO:0010654Biological Processapical cell fate commitment
GO:0048825Biological Processcotyledon development
GO:0080167Biological Processresponse to karrikin
GO:0090451Biological Processcotyledon boundary formation
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 248 aa     Download sequence    Send to blast
MEGSGDHHHQ SVNNGNIGGS RWNPTKEQIN MLEGLYRQGL RTPTAEQIQQ ITARLRAFGH  60
IEGKNVFYWF QNHKARQRQK QKQDSFAYFN RFLHHPTPPL LFPSYRNVVC SPCYIPGGKN  120
DLGFYPQYPK VPLPAAGASA KRSKLIPESN TSIDKNHQRY SKPMHHTTSK NDHDQFISSS  180
SHHQETLELF PIHPTGILHA RTGNESENNM ISTSAYNTPT SSSEDNNYGS ADHDHDHGHP  240
FFDFFCRN
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_011077272.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011077272.10.0WUSCHEL-related homeobox 2
TrEMBLA0A4D9BTG58e-81A0A4D9BTG5_SALSN; Uncharacterized protein
STRINGMigut.F01969.1.p5e-78(Erythranthe guttata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA114141925
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G59340.15e-42WUSCHEL related homeobox 2