PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011077039.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family NF-YB
Protein Properties Length: 165aa    MW: 17829.7 Da    PI: 5.7265
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011077039.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB184.39.2e-5824121198
           NF-YB   1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyreleg 95 
                     vreqdrflPian++rimkk+lPan+ki+kdak+tvqecvsefisfvtseasdkcq+ekrktingddllwa+atlGfedy++plkvyl++yreleg
  XP_011077039.1  24 VREQDRFLPIANIGRIMKKALPANGKIAKDAKDTVQECVSEFISFVTSEASDKCQKEKRKTINGDDLLWAMATLGFEDYIAPLKVYLARYRELEG 118
                     69********************************************************************************************* PP

           NF-YB  96 ekk 98 
                     ++k
  XP_011077039.1 119 DTK 121
                     975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.106.5E-5421134IPR009072Histone-fold
SuperFamilySSF471134.66E-4027128IPR009072Histone-fold
PfamPF008088.7E-293094IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006155.5E-205876No hitNo description
PROSITE patternPS0068506177IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006155.5E-207795No hitNo description
PRINTSPR006155.5E-2096114No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 165 aa     Download sequence    Send to blast
MAESPGSHEN GGGGGGDQSP PSSVREQDRF LPIANIGRIM KKALPANGKI AKDAKDTVQE  60
CVSEFISFVT SEASDKCQKE KRKTINGDDL LWAMATLGFE DYIAPLKVYL ARYRELEGDT  120
KGSARGADVS AKKDTSGTQL HSDAQFAHQG SFSQGFSYSN SQIEY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_B6e-4723115294NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
4csr_A6e-4723115294NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtComponent of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_011077039.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011077038.11e-121nuclear transcription factor Y subunit B-1
RefseqXP_020548913.11e-121nuclear transcription factor Y subunit B-1
SwissprotQ8VYK42e-77NFYB8_ARATH; Nuclear transcription factor Y subunit B-8
TrEMBLA0A0N6X6V51e-102A0A0N6X6V5_SALMI; Transcription factor NFYB
STRINGMigut.F02024.1.p3e-96(Erythranthe guttata)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G53340.12e-78nuclear factor Y, subunit B10
Publications ? help Back to Top
  1. Zhao H, et al.
    The Arabidopsis thaliana Nuclear Factor Y Transcription Factors.
    Front Plant Sci, 2016. 7: p. 2045
    [PMID:28119722]