PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011076930.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family MYB_related
Protein Properties Length: 701aa    MW: 78003.7 Da    PI: 4.5943
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011076930.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding32.61.9e-10552593346
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rW++++ el+++av+q+G++  + I + ++  Rt+ q+k+++ k
   XP_011076930.1 552 RWSKQDTELFYEAVRQFGTD-LSMIQQLFP-DRTRRQVKLKYKK 593
                      8*******************.*********.***********87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF159631.5E-27545626No hitNo description
PROSITE profilePS512939.091548596IPR017884SANT domain
SMARTSM007172.7E-7549597IPR001005SANT/Myb domain
CDDcd001674.49E-7552593No hitNo description
Gene3DG3DSA:1.10.10.603.1E-5552593IPR009057Homeodomain-like
SuperFamilySSF466893.89E-10552599IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 701 aa     Download sequence    Send to blast
MGIDLDPLDD IFADEAVKNA RAVGKFQPKS KFRPPRKDAA ATSLSSSQAA QTIDPAQNES  60
SDPLRTAKSS ENVISGLDVV FNDDGGWHAS IEKSGTENAD IFIGLEALGD FLPHTTSDMA  120
EGTIHPSEEV ALNVHNHENT GGGPAPVLSS VGDSNHTCKV ADVPTCHELS AAVDPLTAGE  180
PIVSSSDGCG RMHVKELGRE EMDIMDSINA SEVTTNSGHR TGKFQPKPKL QMHEVICKPA  240
ESLSCSLGSQ SFPPEISYTE KDFSPTFQQD DVLDLSSLGF THTLPTEASS ELPLNEESMN  300
LTEMTQLDSG IPLECPPEIP AKLASRRAKI GRNKTQTASD PSQQQQKTST SSQENEMGRS  360
LRPRKSKTNF CELGDEVEDG VHASEEFSEE CPVNSAAEEE NVDNEEFQVE SDSQMKKVKQ  420
KFEKPVRKRK ETEASDKDAK PKKFSHSTRR RRVDKVLLAT PEDEIDYQKV PLRDLILLAE  480
HKEREMKKEE AAAGVTAKKQ SNGNSSSRYN QEEAFTSEQN GEYNDGQGSP RIEESTICFN  540
YHTHMDRTPS IRWSKQDTEL FYEAVRQFGT DLSMIQQLFP DRTRRQVKLK YKKEERQHPL  600
RLREALTNRT KDHSHFEKVI ERLKQIAAEE NQNADNDESI DLTGNEVDEG TLNAGDEEAK  660
DEHIEEEVNE GVANDFAEVR SPSKSEDIED DLFIWSQYKS G
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1423429KPVRKRK
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_011076930.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011076930.10.0transcription factor TFIIIB component B''-like
TrEMBLA0A2G9GU170.0A0A2G9GU17_9LAMI; Uncharacterized protein
STRINGMigut.F00900.1.p0.0(Erythranthe guttata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA59022326
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G39160.12e-42MYB_related family protein