PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011076610.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family LBD
Protein Properties Length: 223aa    MW: 24272.9 Da    PI: 8.7164
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011076610.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260133.96.2e-42451441100
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     +CaaCk+lrr+Ca++C+++pyf  ++p+kfa vhk+FGasnv+k+l ++pe++r da++slvyeA++r+rdPvyG++g i++lqqq++ l+ael+
  XP_011076610.1  45 PCAACKLLRRRCAQECPFSPYFSPHEPQKFASVHKVFGASNVSKMLMEVPESQRADAANSLVYEANVRLRDPVYGCMGAISALQQQVQVLQAELN 139
                     7********************************************************************************************** PP

          DUF260  96 llkee 100
                     ++++e
  XP_011076610.1 140 AVRAE 144
                     *9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.73744145IPR004883Lateral organ boundaries, LOB
PfamPF031955.6E-4245142IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 223 aa     Download sequence    Send to blast
MSTERERLDQ EIGKKIKRES DAFPHQMGGR RHMLGPSGTL NTITPCAACK LLRRRCAQEC  60
PFSPYFSPHE PQKFASVHKV FGASNVSKML MEVPESQRAD AANSLVYEAN VRLRDPVYGC  120
MGAISALQQQ VQVLQAELNA VRAEILKYKY RETSMLPTSH VTLLSSGAVS IAAPPPTPLP  180
PPPPPPPPPS LPLTPSSSPI YTPVTSTAAD FTAISTENIT YFG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A1e-464515911125LOB family transfactor Ramosa2.1
5ly0_B1e-464515911125LOB family transfactor Ramosa2.1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_011076610.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011076610.11e-163LOB domain-containing protein 15
SwissprotQ8L5T52e-86LBD15_ARATH; LOB domain-containing protein 15
TrEMBLA0A061FRT31e-112A0A061FRT3_THECC; LOB domain-containing protein 15
STRINGEOY200401e-113(Theobroma cacao)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA4324669
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40470.12e-85LOB domain-containing protein 15
Publications ? help Back to Top
  1. Ohashi-Ito K,Iwamoto K,Fukuda H
    LOB DOMAIN-CONTAINING PROTEIN 15 Positively Regulates Expression of VND7, a Master Regulator of Tracheary Elements.
    Plant Cell Physiol., 2018. 59(5): p. 989-996
    [PMID:29444288]