PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011076209.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family HD-ZIP
Protein Properties Length: 743aa    MW: 81796.3 Da    PI: 6.7444
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011076209.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox64.71.3e-2054109156
                     TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                     r+k +++t++q++eLe+ F+ n++p+++ r eL k+lgL+ rqVk+WFqNrR+++k
  XP_011076209.1  54 RKKYHRHTAYQIQELEASFKDNPHPDEKGRLELGKRLGLEPRQVKFWFQNRRTQMK 109
                     7999*************************************************999 PP

2START1947.2e-612594821205
                     HHHHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EEEEE CS
           START   1 elaeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla....kaetl 82 
                     ela++a++el+k+a++++p+W +s     es+n de++++f++  +     + +ea ra+g v+ ++  lve l+d++ qW+e+++    +a+tl
  XP_011076209.1 259 ELALAAMDELMKLAQLDSPLWYRSLdgggESLNLDEYMKTFPPCIGvkpnhFVTEATRATGTVIINSLALVEALMDVN-QWTEMFPwnigRASTL 352
                     5899***************************************998999999**************************.**************** PP

                     EEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEEEEEEEE-E CS
           START  83 evissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskvtwvehv 170
                     +vi++g      galqlm+ae+q+lsp+vp R + fvR+++q+g++ w++vdvSvd   +      +v +++lpSg++++ ++ng skvtwveh+
  XP_011076209.1 353 NVICPGmagnrnGALQLMQAEFQVLSPMVPvRQVKFVRFCKQHGQDMWAVVDVSVDTIFHGIRGNTSVNCRRLPSGCIVQNMANGCSKVTWVEHT 447
                     ************************************************************988999***************************** PP

                     E--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXX CS
           START 171 dlkgrlphwllrslvksglaegaktwvatlqrqce 205
                     +++++++h+l+r+l++sgla+ga++wva lqrqce
  XP_011076209.1 448 EYDENIIHNLYRPLLRSGLAFGAQKWVANLQRQCE 482
                     **********************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466897.94E-2040111IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.5E-2148119IPR009057Homeodomain-like
PROSITE profilePS5007118.04251111IPR001356Homeobox domain
SMARTSM003897.6E-2053115IPR001356Homeobox domain
CDDcd000867.30E-1954111No hitNo description
PfamPF000464.1E-1854109IPR001356Homeobox domain
PROSITE profilePS5084840.433250486IPR002913START domain
SuperFamilySSF559611.92E-29252482No hitNo description
CDDcd088757.83E-109254482No hitNo description
PfamPF018528.6E-53259482IPR002913START domain
SMARTSM002346.8E-42259483IPR002913START domain
SuperFamilySSF559611.51E-15517737No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0008289Molecular Functionlipid binding
Sequence ? help Back to Top
Protein Sequence    Length: 743 aa     Download sequence    Send to blast
MENLGEMGLM GENYDSGLMG RTREDELDSR SGSDNFETAS GDDQNTTENK SSKRKKYHRH  60
TAYQIQELEA SFKDNPHPDE KGRLELGKRL GLEPRQVKFW FQNRRTQMKT QLERHENSIL  120
KQENDKLRIE NIAMKEAMRN PICENCGSPA ILGEVPIEQH HLMIENARLK DELSRLGILA  180
NKFLTRNGGS MPPMVCNSKL DLAVGRNSFC GLNSIDSALP LGLDFGNRVP NAFPMMQTNG  240
PAVGMMGVDA PLDQSLFPEL ALAAMDELMK LAQLDSPLWY RSLDGGGESL NLDEYMKTFP  300
PCIGVKPNHF VTEATRATGT VIINSLALVE ALMDVNQWTE MFPWNIGRAS TLNVICPGMA  360
GNRNGALQLM QAEFQVLSPM VPVRQVKFVR FCKQHGQDMW AVVDVSVDTI FHGIRGNTSV  420
NCRRLPSGCI VQNMANGCSK VTWVEHTEYD ENIIHNLYRP LLRSGLAFGA QKWVANLQRQ  480
CELFATIRSS MASSRDNSAL SANNKSIVML AQRMTRSFCT GVCATVHKWE VVQSSDNTKL  540
MMRKSMGNPG EPPGVIMSAT TTVWMPVLPH HLLEFLQNEK MRSHWDVLSQ DGPMQQMLQI  600
PKGQDPGNNI CLLSTSAPAS SANQSSVLIL QDTCTDTSGS LIVHAAVETT SMNIVVNSGD  660
SSSIAILPSG FAIVPDCYSN SNNSENGNEG HRGGGRSGSL LTVGFQILVN NLPAAKLTME  720
SVDTVKSLIA RTLQGIKSGL QCS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011076209.10.0PREDICTED: homeobox-leucine zipper protein ANTHOCYANINLESS 2 isoform X2
RefseqXP_011076210.10.0PREDICTED: homeobox-leucine zipper protein ANTHOCYANINLESS 2 isoform X2
SwissprotQ0WV120.0ANL2_ARATH; Homeobox-leucine zipper protein ANTHOCYANINLESS 2
TrEMBLA0A022QAU90.0A0A022QAU9_ERYGU; Uncharacterized protein
STRINGVIT_15s0048g02000.t010.0(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00730.10.0HD-ZIP family protein