PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011076208.1
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family HD-ZIP
Protein Properties Length: 811aa    MW: 88548 Da    PI: 6.931
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011076208.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
        Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                     r+k +++t++q++eLe+ F+ n++p+++ r eL k+lgL+ rqVk+WFqNrR+++k
                     7999*************************************************999 PP

           START   1 elaeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla....kaetl 82 
                     ela++a++el+k+a++++p+W +s     es+n de++++f++  +     + +ea ra+g v+ ++  lve l+d++ qW+e+++    +a+tl
                     5899***************************************998999999**************************.**************** PP

           START  83 evissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskvtwvehv 170
                     +vi++g      galqlm+ae+q+lsp+vp R + fvR+++q+g++ w++vdvSvd   +      +v +++lpSg++++ ++ng skvtwveh+
                     ************************************************************988999***************************** PP

           START 171 dlkgrlphwllrslvksglaegaktwvatlqrqce 205
                     +++++++h+l+r+l++sgla+ga++wva lqrqce
                     **********************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007118.042119179IPR001356Homeobox domain
SMARTSM003897.6E-20121183IPR001356Homeobox domain
PfamPF000464.6E-18122177IPR001356Homeobox domain
CDDcd000868.57E-19122179No hitNo description
PROSITE profilePS5084840.433318554IPR002913START domain
SuperFamilySSF559612.2E-29320550No hitNo description
CDDcd088753.87E-108322550No hitNo description
PfamPF018521.0E-52327550IPR002913START domain
SMARTSM002346.8E-42327551IPR002913START domain
SuperFamilySSF559611.79E-15585805No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0008289Molecular Functionlipid binding
Sequence ? help Back to Top
Protein Sequence    Length: 811 aa     Download sequence    Send to blast
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in the regulation of the tissue-specific accumulation of anthocyanins and in cellular organization of the primary root. {ECO:0000269|PubMed:10402424}.
Cis-element ? help Back to Top
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011076208.10.0homeobox-leucine zipper protein ANTHOCYANINLESS 2
SwissprotQ0WV120.0ANL2_ARATH; Homeobox-leucine zipper protein ANTHOCYANINLESS 2
TrEMBLA0A4D9BN740.0A0A4D9BN74_SALSN; Homeobox-leucine zipper protein
STRINGMigut.F00362.1.p0.0(Erythranthe guttata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00730.10.0HD-ZIP family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78