PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011076208.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family HD-ZIP
Protein Properties Length: 811aa    MW: 88548 Da    PI: 6.931
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011076208.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox64.51.5e-20122177156
                     TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                     r+k +++t++q++eLe+ F+ n++p+++ r eL k+lgL+ rqVk+WFqNrR+++k
  XP_011076208.1 122 RKKYHRHTAYQIQELEASFKDNPHPDEKGRLELGKRLGLEPRQVKFWFQNRRTQMK 177
                     7999*************************************************999 PP

2START193.78.5e-613275501205
                     HHHHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EEEEE CS
           START   1 elaeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla....kaetl 82 
                     ela++a++el+k+a++++p+W +s     es+n de++++f++  +     + +ea ra+g v+ ++  lve l+d++ qW+e+++    +a+tl
  XP_011076208.1 327 ELALAAMDELMKLAQLDSPLWYRSLdgggESLNLDEYMKTFPPCIGvkpnhFVTEATRATGTVIINSLALVEALMDVN-QWTEMFPwnigRASTL 420
                     5899***************************************998999999**************************.**************** PP

                     EEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEEEEEEEE-E CS
           START  83 evissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskvtwvehv 170
                     +vi++g      galqlm+ae+q+lsp+vp R + fvR+++q+g++ w++vdvSvd   +      +v +++lpSg++++ ++ng skvtwveh+
  XP_011076208.1 421 NVICPGmagnrnGALQLMQAEFQVLSPMVPvRQVKFVRFCKQHGQDMWAVVDVSVDTIFHGIRGNTSVNCRRLPSGCIVQNMANGCSKVTWVEHT 515
                     ************************************************************988999***************************** PP

                     E--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXX CS
           START 171 dlkgrlphwllrslvksglaegaktwvatlqrqce 205
                     +++++++h+l+r+l++sgla+ga++wva lqrqce
  XP_011076208.1 516 EYDENIIHNLYRPLLRSGLAFGAQKWVANLQRQCE 550
                     **********************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466899.19E-20108179IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.7E-21116187IPR009057Homeodomain-like
PROSITE profilePS5007118.042119179IPR001356Homeobox domain
SMARTSM003897.6E-20121183IPR001356Homeobox domain
PfamPF000464.6E-18122177IPR001356Homeobox domain
CDDcd000868.57E-19122179No hitNo description
PROSITE profilePS5084840.433318554IPR002913START domain
SuperFamilySSF559612.2E-29320550No hitNo description
CDDcd088753.87E-108322550No hitNo description
PfamPF018521.0E-52327550IPR002913START domain
SMARTSM002346.8E-42327551IPR002913START domain
SuperFamilySSF559611.79E-15585805No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0008289Molecular Functionlipid binding
Sequence ? help Back to Top
Protein Sequence    Length: 811 aa     Download sequence    Send to blast
MSFGGFTGKS SGGGVSDHSG GGGKMVADGL CSYGIMSTGA ISQPLQMVHS SHSQPMFISP  60
PLSLALPKME NLGEMGLMGE NYDSGLMGRT REDELDSRSG SDNFETASGD DQNTTENKSS  120
KRKKYHRHTA YQIQELEASF KDNPHPDEKG RLELGKRLGL EPRQVKFWFQ NRRTQMKTQL  180
ERHENSILKQ ENDKLRIENI AMKEAMRNPI CENCGSPAIL GEVPIEQHHL MIENARLKDE  240
LSRLGILANK FLTRNGGSMP PMVCNSKLDL AVGRNSFCGL NSIDSALPLG LDFGNRVPNA  300
FPMMQTNGPA VGMMGVDAPL DQSLFPELAL AAMDELMKLA QLDSPLWYRS LDGGGESLNL  360
DEYMKTFPPC IGVKPNHFVT EATRATGTVI INSLALVEAL MDVNQWTEMF PWNIGRASTL  420
NVICPGMAGN RNGALQLMQA EFQVLSPMVP VRQVKFVRFC KQHGQDMWAV VDVSVDTIFH  480
GIRGNTSVNC RRLPSGCIVQ NMANGCSKVT WVEHTEYDEN IIHNLYRPLL RSGLAFGAQK  540
WVANLQRQCE LFATIRSSMA SSRDNSALSA NNKSIVMLAQ RMTRSFCTGV CATVHKWEVV  600
QSSDNTKLMM RKSMGNPGEP PGVIMSATTT VWMPVLPHHL LEFLQNEKMR SHWDVLSQDG  660
PMQQMLQIPK GQDPGNNICL LSTSAPASSA NQSSVLILQD TCTDTSGSLI VHAAVETTSM  720
NIVVNSGDSS SIAILPSGFA IVPDCYSNSN NSENGNEGHR GGGRSGSLLT VGFQILVNNL  780
PAAKLTMESV DTVKSLIART LQGIKSGLQC S
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011076208.10.0PREDICTED: homeobox-leucine zipper protein ANTHOCYANINLESS 2 isoform X1
SwissprotQ0WV120.0ANL2_ARATH; Homeobox-leucine zipper protein ANTHOCYANINLESS 2
TrEMBLA0A022QAU90.0A0A022QAU9_ERYGU; Uncharacterized protein
STRINGVIT_15s0048g02000.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA16262465
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00730.10.0HD-ZIP family protein