PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011076102.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family MYB_related
Protein Properties Length: 307aa    MW: 34049.4 Da    PI: 8.2534
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011076102.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding38.72.4e-1256100147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      r +WT+ E++++++a +++  + Wk+I + +g  +t  q++s+ qky
   XP_011076102.1  56 RESWTEPEHDKFLEALQLFDRD-WKKIEAFVG-SKTVIQIRSHAQKY 100
                      789*****************77.*********.*************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.99E-1650106IPR009057Homeodomain-like
PROSITE profilePS5129414.1851105IPR017930Myb domain
Gene3DG3DSA:1.10.10.606.2E-654106IPR009057Homeodomain-like
TIGRFAMsTIGR015571.4E-1854103IPR006447Myb domain, plants
SMARTSM007176.5E-1055103IPR001005SANT/Myb domain
PfamPF002494.4E-1056100IPR001005SANT/Myb domain
CDDcd001671.13E-758101No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0046686Biological Processresponse to cadmium ion
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 307 aa     Download sequence    Send to blast
MVSLNTSPRE CFYLDPTGMA LPNLGSFSSP AAGNTTSPVE DPSKKVRKPY TITKSRESWT  60
EPEHDKFLEA LQLFDRDWKK IEAFVGSKTV IQIRSHAQKY FLKVQKSGTN EHLPPPRPKR  120
KAAHPYPQKA SKIAPVVSQE LSSFHASSAV PDPGFIRRPD SSALVGNPDT SIPGWTDKPV  180
HSTSFSHVTR EDARSAGQSL RNIYSCGSTE STPRTRPTVL PDFAQVYSFI GSVFDPKVTG  240
HLQKLKKMDP IDIETVLLLM RNLSVNLASP DFEDHRRLLS SYEIDLEKDH AFDGADPILG  300
SHPEDAA
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00625PBMTransfer from PK02532.1Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_011076102.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011076102.10.0protein REVEILLE 6 isoform X3
SwissprotQ8H0W31e-110RVE6_ARATH; Protein REVEILLE 6
TrEMBLA0A2G9GHV30.0A0A2G9GHV3_9LAMI; Zuotin
STRINGMigut.F00285.1.p1e-160(Erythranthe guttata)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G52660.21e-97MYB_related family protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Gray JA,Shalit-Kaneh A,Chu DN,Hsu PY,Harmer SL
    The REVEILLE Clock Genes Inhibit Growth of Juvenile and Adult Plants by Control of Cell Size.
    Plant Physiol., 2017. 173(4): p. 2308-2322
    [PMID:28254761]