PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011075911.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family HD-ZIP
Protein Properties Length: 211aa    MW: 24901.5 Da    PI: 4.7998
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011075911.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox60.42.8e-192172556
                    SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox  5 ttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                    ++ft+eq++ Le+ Fe++ ++  +++ e A+ lgL+ rqV +WFqNrRa++k
  XP_011075911.1 21 RRFTNEQIRSLETIFEMETKLEPRKKHEVARDLGLQPRQVAIWFQNRRARWK 72
                    68*************************************************9 PP

2HD-ZIP_I/II120.96.7e-3920110393
     HD-ZIP_I/II   3 krrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelke 93 
                      rr+++eq+++LE+ Fe+e+kLep++K+e+ar+Lglqprqva+WFqnrRAR+k+kqlE++y++Lk++yd l  + ++L++e+++L+ +l+e
  XP_011075911.1  20 ARRFTNEQIRSLETIFEMETKLEPRKKHEVARDLGLQPRQVAIWFQNRRARWKSKQLEQEYKVLKTNYDGLCMQFDHLKREKQSLQMQLQE 110
                     69*************************************************************************************9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.71E-18776IPR009057Homeodomain-like
PROSITE profilePS5007117.3291474IPR001356Homeobox domain
SMARTSM003895.9E-161778IPR001356Homeobox domain
CDDcd000861.39E-131875No hitNo description
PfamPF000461.2E-162172IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.607.6E-192181IPR009057Homeodomain-like
PRINTSPR000311.5E-54554IPR000047Helix-turn-helix motif
PROSITE patternPS0002704972IPR017970Homeobox, conserved site
PRINTSPR000311.5E-55470IPR000047Helix-turn-helix motif
PfamPF021831.7E-1374114IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 211 aa     Download sequence    Send to blast
MESPHEENPH RSTRKTSKNA RRFTNEQIRS LETIFEMETK LEPRKKHEVA RDLGLQPRQV  60
AIWFQNRRAR WKSKQLEQEY KVLKTNYDGL CMQFDHLKRE KQSLQMQLQE LTDLVKNLDN  120
VGISDGDAEL KEDPNSSNEG MDHNDAMYTD DEETVTKYFK ETEEQEPLSW GTEQVEISHL  180
ESPETWCNDL SSGSLFDQSS CKSNWWESLK I
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
16674RRARWKSKQ
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00650PBMTransfer from LOC_Os09g35910Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011075911.11e-157PREDICTED: homeobox-leucine zipper protein ATHB-12-like
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA20412363
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G46680.15e-41homeobox 7