PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011075906.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family GRF
Protein Properties Length: 507aa    MW: 54311.3 Da    PI: 6.6725
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011075906.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC74.51.1e-23180223144
             WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkske 44 
                     d+epgrC+RtDGKkWRCsr+v + +k+CErHlhrgr rsrk++e
  XP_011075906.1 180 DPEPGRCKRTDGKKWRCSRDVAPHQKYCERHLHRGRPRSRKPVE 223
                     79***************************************998 PP

2QLQ56.58.5e-20119153236
             QLQ   2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiq 36 
                     +FT aQ+ +L++Q+++yKy+++++PvPp+Ll++++
  XP_011075906.1 119 PFTSAQWKELERQAMIYKYMMSSVPVPPDLLFPLS 153
                     8*******************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009511.7E-12118154IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166621.728119154IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088804.7E-14119152IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166725.072180224IPR014977WRC domain
PfamPF088791.2E-19181223IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 507 aa     Download sequence    Send to blast
MKLHSTEAFP SKICMTSVHQ ENNLHLGRPF DGGCGGGRRS VASPAGGGVG PTSSNSGGAN  60
EVVGNINRDD VSSSCGVGEN FARSSSTNSQ PFDIFGAAHS HSTTPYKSPG GMAANVGFPF  120
TSAQWKELER QAMIYKYMMS SVPVPPDLLF PLSRSFPTAA AAVDSSASSL YHGRYSKNGD  180
PEPGRCKRTD GKKWRCSRDV APHQKYCERH LHRGRPRSRK PVEVKNNGES HKKTRLEQSS  240
LPNSTPSQQF VAANDQPLML FNANTDLSIS TAPSYNKGTN RDLGLMMEGE MVAMNGADQK  300
WQHLIEANMG IANEGSFIYS SSALFHQDYV EEQPLNVLSY PNFPAPETEV PAGFIDAWSI  360
DNLNSNNNGS SEPSISTNLG NLSPSLNLSI AMAAGSLLDE EMGKVQMGGS VKFYDEQSTK  420
DSSWLSPVSW EPFARGGPLA EALHPGSVTI GCINPASPHD SISTPATTVS SPSGVLQRTL  480
FSHSDSSVCN SPTFAAPPSE VAFQRLN
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_011075906.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ0506894e-37KJ050689.1 Sesamum indicum clone TilSSR_21890 microsatellite Sesame_21890 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011075906.10.0growth-regulating factor 2
TrEMBLA0A2G9HZL00.0A0A2G9HZL0_9LAMI; Uncharacterized protein
STRINGXP_009597554.11e-103(Nicotiana tomentosiformis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA70322230
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37740.15e-37growth-regulating factor 2