PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011075631.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family HD-ZIP
Protein Properties Length: 221aa    MW: 24777.1 Da    PI: 6.361
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011075631.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox59.17.3e-1976130256
                     T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                     rk+ ++tkeq + Le+ F +n++++ +e+  LA++l+L+ rqV vWFqNrRa+ k
  XP_011075631.1  76 RKKLRLTKEQSRLLEQTFLQNHTLNPKEKDALAAELKLKARQVEVWFQNRRARSK 130
                     78889************************************************98 PP

2HD-ZIP_I/II1117.8e-3676164190
     HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLree 90 
                     +kk+rl+keq++lLE++F ++++L+p++K +la eL+l++rqv+vWFqnrRAR k+kq+E+++e+Lkr++ +l e+n+rL+keveeLr +
  XP_011075631.1  76 RKKLRLTKEQSRLLEQTFLQNHTLNPKEKDALAAELKLKARQVEVWFQNRRARSKMKQTEMECEYLKRWFATLIEQNRRLQKEVEELR-A 164
                     69*************************************************************************************9.4 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.5E-1856130IPR009057Homeodomain-like
SuperFamilySSF466891.3E-1866133IPR009057Homeodomain-like
PROSITE profilePS5007117.36272132IPR001356Homeobox domain
SMARTSM003891.4E-1674136IPR001356Homeobox domain
CDDcd000861.06E-1675130No hitNo description
PfamPF000463.0E-1676130IPR001356Homeobox domain
PROSITE patternPS000270107130IPR017970Homeobox, conserved site
SMARTSM003401.2E-20132175IPR003106Leucine zipper, homeobox-associated
PfamPF021833.7E-9132166IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 221 aa     Download sequence    Send to blast
MEIFHHNYST ASLELSIAVP GFSSSPSSGE SCGGAMKELD INQVPSPIEE EECMEEEEED  60
NDSPNNNGIG AASAPRKKLR LTKEQSRLLE QTFLQNHTLN PKEKDALAAE LKLKARQVEV  120
WFQNRRARSK MKQTEMECEY LKRWFATLIE QNRRLQKEVE ELRAMKVAPP HCRQPLPHTM  180
CPCCDRVITT TTTLLEKGPA SGASAATTTS TISSAPITRP Y
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1124132RRARSKMKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ0546401e-56KJ054640.1 Sesamum indicum clone TilSSR_25841 microsatellite Sesame_25841 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011075631.11e-165PREDICTED: homeobox-leucine zipper protein HOX3-like
SwissprotQ8S9N67e-66ATB17_ARATH; Homeobox-leucine zipper protein ATHB-17
TrEMBLD7T8T68e-76D7T8T6_VITVI; Putative uncharacterized protein
STRINGVIT_01s0011g04870.t012e-75(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA29024186
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01430.17e-50homeobox-leucine zipper protein 17