PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011075470.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family HD-ZIP
Protein Properties Length: 307aa    MW: 34765.9 Da    PI: 6.5067
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011075470.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox55.97.2e-1893146356
                     --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                     k+++++ eq+++Le+ Fe  +++  e++ +LA+ lgL+ rq+ +WFqNrRa++k
  XP_011075470.1  93 KKRRLNMEQVKTLEKNFELGNKLEPERKMQLARALGLQPRQIAIWFQNRRARWK 146
                     456899***********************************************9 PP

2HD-ZIP_I/II129.11.8e-4192182191
     HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                     ekkrrl+ eqvk+LE++Fe  +kLeperK++lar+Lglqprq+a+WFqnrRAR+ktkqlEkdy+ Lkr+++a+k+en++L++++++L++e+
  XP_011075470.1  92 EKKRRLNMEQVKTLEKNFELGNKLEPERKMQLARALGLQPRQIAIWFQNRRARWKTKQLEKDYDLLKRQFEAVKAENDALQAHNHKLHAEI 182
                     69**************************************************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.31E-1982150IPR009057Homeodomain-like
PROSITE profilePS5007117.11988148IPR001356Homeobox domain
SMARTSM003891.8E-1791152IPR001356Homeobox domain
PfamPF000463.2E-1593146IPR001356Homeobox domain
CDDcd000861.99E-1693149No hitNo description
Gene3DG3DSA:1.10.10.605.3E-1995155IPR009057Homeodomain-like
PRINTSPR000311.3E-5119128IPR000047Helix-turn-helix motif
PROSITE patternPS000270123146IPR017970Homeobox, conserved site
PRINTSPR000311.3E-5128144IPR000047Helix-turn-helix motif
PfamPF021836.6E-15148188IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 307 aa     Download sequence    Send to blast
MTCEMAFFHS NFMLQTPPHQ EDHDQNHPST SLPPISLPSC TPQEFHGGVA SLLAGKRSSM  60
SFSTGIDVCE DHMNNHNHGE DELSDDGSQV GEKKRRLNME QVKTLEKNFE LGNKLEPERK  120
MQLARALGLQ PRQIAIWFQN RRARWKTKQL EKDYDLLKRQ FEAVKAENDA LQAHNHKLHA  180
EILALKSREP TESINLNKET EGSCSNRSEN SSEIKLDIST TTPAATCTES PLSTHPIPRA  240
LFPSTSSLSR PGGVVAHQLF HNSSSRPEIH HCPKMDQTVK EESLCNMFVG MDDQTGFWPW  300
LEQQNFN
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1140148RRARWKTKQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that may act in the sucrose-signaling pathway. {ECO:0000269|PubMed:11292072}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_011075470.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011075470.10.0homeobox-leucine zipper protein ATHB-13
SwissprotQ8LC031e-112ATB13_ARATH; Homeobox-leucine zipper protein ATHB-13
TrEMBLA0A2G9GFL11e-167A0A2G9GFL1_9LAMI; Transcription factor HEX
STRINGVIT_01s0026g01950.t011e-153(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA8482498
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69780.11e-109HD-ZIP family protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Ribone PA,Capella M,Chan RL
    Functional characterization of the homeodomain leucine zipper I transcription factor AtHB13 reveals a crucial role in Arabidopsis development.
    J. Exp. Bot., 2015. 66(19): p. 5929-43
    [PMID:26136262]
  3. Wang X, et al.
    Overexpressed BRH1, a RING finger gene, alters rosette leaf shape in Arabidopsis thaliana.
    Sci China Life Sci, 2018. 61(1): p. 79-87
    [PMID:28887625]
  4. Ebrahimian-Motlagh S, et al.
    JUNGBRUNNEN1 Confers Drought Tolerance Downstream of the HD-Zip I Transcription Factor AtHB13.
    Front Plant Sci, 2017. 8: p. 2118
    [PMID:29326734]