PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011075258.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family HD-ZIP
Protein Properties Length: 325aa    MW: 36157.6 Da    PI: 7.7299
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011075258.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox55.59.5e-18179233256
                     T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                     rk+ +++keq   Lee F+++++++ +++  LAk+l+L  rqV vWFqNrRa+ k
  XP_011075258.1 179 RKKLRLSKEQSAFLEESFKEHNTLNPKQKLALAKQLNLRPRQVEVWFQNRRARTK 233
                     788899***********************************************98 PP

2HD-ZIP_I/II127.65.3e-41179268191
     HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                     +kk+rlskeq+++LEesF+e+++L+p++K +la++L+l+prqv+vWFqnrRARtk+kq+E+d+e+Lk+++++l+een+rL+ke +eLr +l
  XP_011075258.1 179 RKKLRLSKEQSAFLEESFKEHNTLNPKQKLALAKQLNLRPRQVEVWFQNRRARTKLKQTEVDCEYLKKCCETLTEENRRLQKELQELR-AL 268
                     69*************************************************************************************9.55 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466893.51E-18173236IPR009057Homeodomain-like
PROSITE profilePS5007116.763175235IPR001356Homeobox domain
SMARTSM003897.7E-15177239IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.604.6E-17179233IPR009057Homeodomain-like
CDDcd000864.11E-16179236No hitNo description
PfamPF000463.2E-15179233IPR001356Homeobox domain
PROSITE patternPS000270210233IPR017970Homeobox, conserved site
SMARTSM003401.6E-25235278IPR003106Leucine zipper, homeobox-associated
PfamPF021832.7E-10235269IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 325 aa     Download sequence    Send to blast
MELALSLGDT PKPFSLLEKS QKILGKDLGF CMGMAVGKSD AENNSRCKET TGLFSADDDQ  60
RRSDSSSDLP VQLDLLPFSP VHRSHPSSHK FPFPWLTEKL GGDGVEGNMR RGGDEGHDQE  120
GASLSSPNSA VSSFQMDFCH VLRSGKRDFE QITSAGHEAA DRGTCSRGSD EEENGMLARK  180
KLRLSKEQSA FLEESFKEHN TLNPKQKLAL AKQLNLRPRQ VEVWFQNRRA RTKLKQTEVD  240
CEYLKKCCET LTEENRRLQK ELQELRALKA SQPFYMQLPA TTLTMCPSCE RVATTTTTTT  300
TTSSAAINNP SKLFSLSPPH QPASN
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1227235RRARTKLKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ0503604e-61KJ050360.1 Sesamum indicum clone TilSSR_21561 microsatellite Sesame_21561 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011075258.10.0PREDICTED: homeobox-leucine zipper protein HOX11
SwissprotP466654e-89HAT14_ARATH; Homeobox-leucine zipper protein HAT14
TrEMBLA0A068URD41e-132A0A068URD4_COFCA; Uncharacterized protein
STRINGPOPTR_0016s05890.11e-122(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA29024186
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06710.13e-62homeobox from Arabidopsis thaliana