PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011073164.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family ZF-HD
Protein Properties Length: 172aa    MW: 19005.1 Da    PI: 8.1419
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011073164.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer88.85.2e-28961559
     ZF-HD_dimer  5 rYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrevee 59
                     Y+eCl+NhAaslG++a+DGCgEf+ +  +++   +l+CaACgCHRnFHR+   +
  XP_011073164.1  9 IYRECLRNHAASLGSYATDGCGEFTLD--DTAPGGGLNCAACGCHRNFHRKVIRS 61
                    7*************************8..4456799***************8765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF047704.8E-23958IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
ProDomPD1257743.0E-171057IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015662.1E-221057IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152322.341058IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
SuperFamilySSF466895.6E-1787157IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.608.6E-2990157IPR009057Homeodomain-like
TIGRFAMsTIGR015655.5E-3099157IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 172 aa     Download sequence    Send to blast
MEGDSSNDIY RECLRNHAAS LGSYATDGCG EFTLDDTAPG GGLNCAACGC HRNFHRKVIR  60
SQTHDAAADV IVDYASGGSG RQQVTGMAYS PESSERGSKK RFRTKFTAEQ KEKMLGFAEK  120
LGWKLQRKDE EDEIERFCRG VGISRKVFKV WMHNHKNSPP HSAGNVSSLT DQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A5e-23981621679ZF-HD homeobox family protein
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtEssential protein. Putative transcription factor.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_011073164.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011073164.11e-128zinc-finger homeodomain protein 7-like
SwissprotQ9SB614e-40ZHD2_ARATH; Zinc-finger homeodomain protein 2
TrEMBLA0A2G9FYN71e-98A0A2G9FYN7_9LAMI; Uncharacterized protein
STRINGMigut.I00573.1.p1e-81(Erythranthe guttata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA118652023
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24660.12e-42homeobox protein 22
Publications ? help Back to Top
  1. Bueso E,Serrano R,Pallás V,Sánchez-Navarro JA
    Seed tolerance to deterioration in arabidopsis is affected by virus infection.
    Plant Physiol. Biochem., 2017. 116: p. 1-8
    [PMID:28477474]