PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011073138.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family TALE
Protein Properties Length: 603aa    MW: 67128.4 Da    PI: 6.6532
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011073138.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox27.17.3e-093694061954
                     HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
        Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                     Fe   ++yps  ++  LA+++gL+ +qV++WF N R +
  XP_011073138.1 369 FEHflHPYPSDVDKHILARQTGLSRSQVSNWFINARVR 406
                     554458******************************88 PP

2BELL110.59.4e-36233301472
            BELL   4 elqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                     elqk+k+kLl++l+eVd+rYk+y++q+++v+ sFe vag gsa++Y ++A++a+SrhF+cLkd i +qi
  XP_011073138.1 233 ELQKRKTKLLQMLDEVDRRYKHYRDQMKAVVQSFESVAGNGSAQVYSAMASRAMSRHFKCLKDGILSQI 301
                     89*****************************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005748.4E-51171299IPR006563POX domain
PfamPF075265.0E-42178297IPR006563POX domain
PROSITE profilePS5007112.115347410IPR001356Homeobox domain
SMARTSM003891.2E-8350414IPR001356Homeobox domain
CDDcd000867.23E-12350411No hitNo description
SuperFamilySSF466894.71E-17351416IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.1E-27353416IPR009057Homeodomain-like
PfamPF059207.9E-18367406IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 603 aa     Download sequence    Send to blast
MYCMAGAGGV TSTGYCYSDD ASSTGNPNIQ THLLSQLQSF ESNPDIYNLT TSMGMIGFPS  60
KNSVLISPQS ENTSVYHQDS TNGTLMVNSS AWNHHHHHHM NRLLLVEDHD HQDPSLRCAV  120
LGDHHHHERP SHGLSLSLSS SNNLGLQSFA LRLNDDFRFG PSSSRSVNTA TTAQFQPRNS  180
KYLGPAQELL TEFCNLGSDK TSKLKVQKCS GLEDDESDDV KKQSFYSSFD LLELQKRKTK  240
LLQMLDEVDR RYKHYRDQMK AVVQSFESVA GNGSAQVYSA MASRAMSRHF KCLKDGILSQ  300
IKAIKKAMGE KDSAAPGTTK GETPRLRILD QTLRQQRAFQ QMSMIENPPW RPQRGLPERS  360
VSVLRSWLFE HFLHPYPSDV DKHILARQTG LSRSQVSNWF INARVRLWKP MVEEMYLEDL  420
KEGEDMGELD GAANHHENGN QNPPPGNDDQ KPTQDQLIRI DSDYLSSIIN NPGKNDPKAP  480
DKSLGSDHHH HHQESSFSRV GEEYGTSMQF DFSSYSQQAG GATVSYGGGS GVSLTLGLQQ  540
NGASGGVSLA FSPATQSSLF YPRSSDNMED CQTVHQYSLL DSENQNLPYR NLMGAQLLHD  600
LAG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrs_B1e-15356413158Homeobox protein Meis1
4xrs_A1e-15356413158Homeobox protein Meis1
4xrm_B2e-15356414563Homeobox protein Meis2
4xrm_A2e-15356414563Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ0774174e-56KJ077417.1 Sesamum indicum clone TilSSR_48618 microsatellite Sesame_48618 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011073138.10.0PREDICTED: homeobox protein BEL1 homolog
SwissprotQ388971e-130BEL1_ARATH; Homeobox protein BEL1 homolog
TrEMBLA0A061G6K40.0A0A061G6K4_THECC; POX family protein isoform 1
STRINGVIT_02s0025g00200.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA53001317
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G41410.11e-118TALE family protein