PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011072582.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family GRAS
Protein Properties Length: 543aa    MW: 60626.6 Da    PI: 6.7496
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011072582.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS247.16.9e-761565362374
            GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshl 96 
                     ++lL  cA a+++++l+++q++L  l++l+s +gd+++Rla + ++AL ++l++   + +++ + ++ ++++ +    al  f+++ P++++ + 
  XP_011072582.1 156 EQLLNPCAAAITARNLSRVQHFLYVLNDLSSLNGDANHRLAYHGLQALTHHLSSAPGSSFSSASGKTFASSSPKFFRDALIKFNDINPWFRIPNN 250
                     689***************************************************6666666777777776666777777777************* PP

            GRAS  97 taNqaIleavege....ervHiiDfdisqGlQWpaLlqaLasRp.egppslRiTgvgspesg..........skeeleetgerLakfAeelgvpf 176
                     + N  Il+ ++++    + +Hi+D+++s+G+QWp+Ll++L+ R+ ++pp +R+T+v++p+s+          +  +     ++L +fA+ +++++
  XP_011072582.1 251 VVNTSILQILAEQgnqqTNLHILDIGVSHGVQWPTLLEELTRRTgGPPPLVRLTVVAPPTSNdqsrhttpfaNGPQNYDFSSKLLSFAKDMNINL 345
                     ********998877776889************************55666*********9998899999998888889999*************** PP

            GRAS 177 efnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadh...nsesFlerflealeyysalf 268
                     +++ +   +l++l+ + ++ + +E+l+V+ +++lh+l    +s+++ r+e+L++++sl+Pk v+++e+++d+   n ++F+++f++ +ey + ++
  XP_011072582.1 346 QISRIENFQLQNLNSQVISSSAEETLVVCAQFRLHNLN---HSTPDDRTEFLRVLRSLQPKGVILSENNTDCscsNCGDFATGFSRRVEYLWRFL 437
                     ****7666*****************************8...77777788******************99555337888***************** PP

            GRAS 269 dsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgslvlgW 362
                     ds+++ +    + r + Er++++ e+ +v+ + g++    +e++ekW er++ +GFk   ++e++ + a++llrk++ +++ rvee++ ++ l W
  XP_011072582.1 438 DSTSVAF----KGRESEERRMMEAEAAKVLINVGEM----NERKEKWCERMKGVGFKVEVFGEETIDGARALLRKYDsNWEIRVEEKDSCVGLWW 524
                     ***8886....6666666666777799999999999....78888********************************9999************** PP

            GRAS 363 kdrpLvsvSaWr 374
                     k++++ ++S W+
  XP_011072582.1 525 KGQQVSFCSLWK 536
                     ***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098539.031129515IPR005202Transcription factor GRAS
PfamPF035142.4E-73156536IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0042446Biological Processhormone biosynthetic process
GO:2000032Biological Processregulation of secondary shoot formation
Sequence ? help Back to Top
Protein Sequence    Length: 543 aa     Download sequence    Send to blast
MTIGEPEPNP PPDHVLGWMG ESVSYFPTFF DDPYETGDFS GDSWWVDGHN LEQDQVNTSA  60
NSFTTNTTSI TPVPTDTVVS NHSIPVDLPK KRKLPDDSSP KAAQKNKNRR VNESDPGPAG  120
AAQGVAPRKP TTHKRGSRSA GSSNNNSNNK EGRWAEQLLN PCAAAITARN LSRVQHFLYV  180
LNDLSSLNGD ANHRLAYHGL QALTHHLSSA PGSSFSSASG KTFASSSPKF FRDALIKFND  240
INPWFRIPNN VVNTSILQIL AEQGNQQTNL HILDIGVSHG VQWPTLLEEL TRRTGGPPPL  300
VRLTVVAPPT SNDQSRHTTP FANGPQNYDF SSKLLSFAKD MNINLQISRI ENFQLQNLNS  360
QVISSSAEET LVVCAQFRLH NLNHSTPDDR TEFLRVLRSL QPKGVILSEN NTDCSCSNCG  420
DFATGFSRRV EYLWRFLDST SVAFKGRESE ERRMMEAEAA KVLINVGEMN ERKEKWCERM  480
KGVGFKVEVF GEETIDGARA LLRKYDSNWE IRVEEKDSCV GLWWKGQQVS FCSLWKMDED  540
RLT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_B7e-3415253684473Protein SHORT-ROOT
5b3h_B4e-3415253630419Protein SHORT-ROOT
5b3h_E4e-3415253630419Protein SHORT-ROOT
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional regulator essential for Nod-factor-induced gene expression. Acts downstream of calcium spiking. May be a target of DMI3, a calcium/calmodulin-dependent protein kinase (CCaMK) (PubMed:15961669). Is essential for Nod factor-elicited expression of ERN1 (PubMed:23077241). {ECO:0000269|PubMed:15961669, ECO:0000269|PubMed:23077241}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_011072582.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Not induced after treatment with Sinorhizobium meliloti. {ECO:0000269|PubMed:15961669}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011072582.10.0nodulation-signaling pathway 1 protein
SwissprotQ4VYC80.0NSP1_MEDTR; Nodulation-signaling pathway 1 protein
TrEMBLA0A2G9HXR40.0A0A2G9HXR4_9LAMI; Uncharacterized protein
STRINGMigut.I01075.1.p0.0(Erythranthe guttata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA49492139
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13840.11e-147GRAS family protein
Publications ? help Back to Top
  1. Cerri MR, et al.
    Medicago truncatula ERN transcription factors: regulatory interplay with NSP1/NSP2 GRAS factors and expression dynamics throughout rhizobial infection.
    Plant Physiol., 2012. 160(4): p. 2155-72
    [PMID:23077241]
  2. Tang H, et al.
    An improved genome release (version Mt4.0) for the model legume Medicago truncatula.
    BMC Genomics, 2014. 15: p. 312
    [PMID:24767513]