PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011072373.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family HD-ZIP
Protein Properties Length: 757aa    MW: 84205.1 Da    PI: 6.9184
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011072373.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox65.76.3e-2196151156
                     TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                     r+k +++t+eq++e+e+lF+++++p++++r +L+++lgL  rqVk+WFqNrR++ k
  XP_011072373.1  96 RKKYHRHTPEQIREMEALFKESPHPDEKQRLQLSRQLGLHPRQVKFWFQNRRTQIK 151
                     7999************************************************9877 PP

2START205.71.9e-642724925206
                     HHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS.......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EEEEEEEE CS
           START   5 eaaqelvkkalaeepgWvkss....esengdevlqkfeeskv......dsgealrasgvvdmvlallveellddkeqWdetla....kaetlevi 85 
                     +a +el+k+a+ + p+W +s+    e++n+de++++f  +++      + +ea+r+sg+ + +l+ lv++++d + qW+e ++    ka+t++vi
  XP_011072373.1 272 RARDELIKMAAQGGPLWIRSYetgrEILNYDEYVKEFCAEDSnrlqpkKCIEASRESGIIFVDLPCLVQSFMDAN-QWKELFPglisKAATVDVI 365
                     6789*********************************8888889***999*************************.******************* PP

                     CTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEEEEEEEE-EE-- CS
           START  86 ssg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskvtwvehvdlk 173
                     ++g      ga++lm+ae q+l+p+v+ R+ +fvRy++ql+a +w+i+dvSv++ +++  ++s+ +++++pSg+lie+ksngh+kvtwveh +++
  XP_011072373.1 366 CNGeganrdGAVHLMFAEVQMLTPMVAsRELYFVRYCKQLSANQWAIADVSVNNVEDNI-DASLQKCRKRPSGCLIEDKSNGHCKVTWVEHLECQ 459
                     *********************************************************98.9********************************** PP

                     SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
           START 174 grlphwllrslvksglaegaktwvatlqrqcek 206
                     ++++h+l+r +v+sgla+gak+w +tlq+qce+
  XP_011072373.1 460 KSTVHSLYRAIVNSGLAFGAKRWISTLQQQCER 492
                     *******************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.8E-2286147IPR009057Homeodomain-like
SuperFamilySSF466893.59E-2186154IPR009057Homeodomain-like
PROSITE profilePS5007117.89693153IPR001356Homeobox domain
SMARTSM003893.8E-1995157IPR001356Homeobox domain
PfamPF000462.2E-1896151IPR001356Homeobox domain
CDDcd000865.81E-17100151No hitNo description
PROSITE patternPS000270128151IPR017970Homeobox, conserved site
SuperFamilySSF559611.36E-30259492No hitNo description
PROSITE profilePS5084836.855259495IPR002913START domain
CDDcd088755.69E-101263491No hitNo description
SMARTSM002347.0E-62268492IPR002913START domain
PfamPF018523.8E-50272492IPR002913START domain
Gene3DG3DSA:3.30.530.204.5E-6332491IPR023393START-like domain
SuperFamilySSF559611.65E-12536745No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009957Biological Processepidermal cell fate specification
GO:0010062Biological Processnegative regulation of trichoblast fate specification
GO:0005634Cellular Componentnucleus
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 757 aa     Download sequence    Send to blast
MSNLHPRDFL PPSPALSLSL AGIFREELAG GGGRSEEAVD ISSSDNSGAG KYSRGSDDDY  60
EMLAAEGEQQ RHNVDDGGDE EEEEGVDVDG KKKKKRKKYH RHTPEQIREM EALFKESPHP  120
DEKQRLQLSR QLGLHPRQVK FWFQNRRTQI KAIQERHENS LLKAEIDKLR NENRAFRDNI  180
KKSSCPNCGF AASCKDAITG STEEQKLRIE NAKLKAELEK LRSIVGKYPY GSSPQNSSSF  240
SPGNDQENRG SLEFCTGSFG LEKSRIMDAV SRARDELIKM AAQGGPLWIR SYETGREILN  300
YDEYVKEFCA EDSNRLQPKK CIEASRESGI IFVDLPCLVQ SFMDANQWKE LFPGLISKAA  360
TVDVICNGEG ANRDGAVHLM FAEVQMLTPM VASRELYFVR YCKQLSANQW AIADVSVNNV  420
EDNIDASLQK CRKRPSGCLI EDKSNGHCKV TWVEHLECQK STVHSLYRAI VNSGLAFGAK  480
RWISTLQQQC ERLVFLVATN VPTKDSSGVA TLAGRKSILK LAHRMTWSFC RALGGSSHNS  540
WNKITSKTGE EIRVASRKNL NDTGEPLGTI LSAVSCVWLP VSHHVLFDFL RDGNRRNEWD  600
IMFNGSRVQS IAKLAKGQDR GNTVSALAMT TDEHKMWLLQ DSSTNAYESM VVYGPVDING  660
MQSVMTGCDS SNIAVLPSGF SILPDGIESR PLVITSRPAE KCTEGGSLLT VVFQILISNS  720
PTAKLSMDSV DSVNTLISCT LQSIKRSLQC EDDDTFI
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
19196KKKKRK
29197KKKKRKK
39397KKRKK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011072373.10.0PREDICTED: homeobox-leucine zipper protein GLABRA 2
SwissprotP466070.0HGL2_ARATH; Homeobox-leucine zipper protein GLABRA 2
TrEMBLA0A068TPQ70.0A0A068TPQ7_COFCA; Uncharacterized protein
STRINGVIT_09s0002g04340.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA62282328
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G79840.10.0HD-ZIP family protein