PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011072373.1
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family HD-ZIP
Protein Properties Length: 757aa    MW: 84205.1 Da    PI: 6.9184
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011072373.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
        Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                     r+k +++t+eq++e+e+lF+++++p++++r +L+++lgL  rqVk+WFqNrR++ k
                     7999************************************************9877 PP

           START   5 eaaqelvkkalaeepgWvkss....esengdevlqkfeeskv......dsgealrasgvvdmvlallveellddkeqWdetla....kaetlevi 85 
                     +a +el+k+a+ + p+W +s+    e++n+de++++f  +++      + +ea+r+sg+ + +l+ lv++++d + qW+e ++    ka+t++vi
                     6789*********************************8888889***999*************************.******************* PP

           START  86 ssg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskvtwvehvdlk 173
                     ++g      ga++lm+ae q+l+p+v+ R+ +fvRy++ql+a +w+i+dvSv++ +++  ++s+ +++++pSg+lie+ksngh+kvtwveh +++
                     *********************************************************98.9********************************** PP

           START 174 grlphwllrslvksglaegaktwvatlqrqcek 206
                     ++++h+l+r +v+sgla+gak+w +tlq+qce+
                     *******************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007117.89693153IPR001356Homeobox domain
SMARTSM003893.8E-1995157IPR001356Homeobox domain
PfamPF000462.2E-1896151IPR001356Homeobox domain
CDDcd000865.81E-17100151No hitNo description
PROSITE patternPS000270128151IPR017970Homeobox, conserved site
SuperFamilySSF559611.36E-30259492No hitNo description
PROSITE profilePS5084836.855259495IPR002913START domain
CDDcd088755.69E-101263491No hitNo description
SMARTSM002347.0E-62268492IPR002913START domain
PfamPF018523.8E-50272492IPR002913START domain
Gene3DG3DSA:3.30.530.204.5E-6332491IPR023393START-like domain
SuperFamilySSF559611.65E-12536745No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009957Biological Processepidermal cell fate specification
GO:0010062Biological Processnegative regulation of trichoblast fate specification
GO:0005634Cellular Componentnucleus
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 757 aa     Download sequence    Send to blast
Nucleic Localization Signal ? help Back to Top
No. Start End Sequence
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor required for correct morphological development and maturation of trichomes as well as for normal development of seed coat mucilage. Regulates the frequency of trichome initiation and determines trichome spacing. {ECO:0000269|PubMed:11844112}.
Cis-element ? help Back to Top
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Down-regulated by GEM. {ECO:0000269|PubMed:17450124}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011072373.10.0homeobox-leucine zipper protein GLABRA 2 isoform X1
SwissprotP466070.0HGL2_ARATH; Homeobox-leucine zipper protein GLABRA 2
TrEMBLA0A2G9G2L40.0A0A2G9G2L4_9LAMI; Transcription factor PHOX2/ARIX, contains HOX domain
STRINGVIT_09s0002g04340.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G79840.10.0HD-ZIP family protein
Publications ? help Back to Top
  1. Wu R,Citovsky V
    Adaptor proteins GIR1 and GIR2. I. Interaction with the repressor GLABRA2 and regulation of root hair development.
    Biochem. Biophys. Res. Commun., 2017. 488(3): p. 547-553