PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011072049.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family MYB_related
Protein Properties Length: 458aa    MW: 50320.9 Da    PI: 5.5682
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011072049.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding48.22.5e-155599147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     r rWT+eE++++v+a k++G   W+ I +++  ++t+ q++s+ qk+
   XP_011072049.1 55 RERWTEEEHKRFVEALKLYGRA-WRQIEEHVA-TKTAIQIRSHAQKF 99
                     78******************88.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466895.83E-1649104IPR009057Homeodomain-like
PROSITE profilePS5129420.0350104IPR017930Myb domain
TIGRFAMsTIGR015571.5E-1653102IPR006447Myb domain, plants
SMARTSM007177.7E-1254102IPR001005SANT/Myb domain
PfamPF002497.9E-125598IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.6E-85595IPR009057Homeodomain-like
CDDcd001675.07E-957100No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 458 aa     Download sequence    Send to blast
MVAEAKDQTA GPCRDAFVAV SSQLESVTTQ SKALSSNGNG YAPKVRKPYT ITKQRERWTE  60
EEHKRFVEAL KLYGRAWRQI EEHVATKTAI QIRSHAQKFF AKVTRDPCVD AEGSLSPIEI  120
PPPRPKKKPL HPYPRKTVDP ANTEVVVSNQ VGGTTESAAE RENYSPTSVF SAIGSDNLES  180
TVAEMHKSRL SPASCATDAL SGNDNEYATS NISSKEEDGF HLSMKISSAS VPDNKTTMKF  240
ELFPQETESS LDSPNAGEPY TSIKLFGKTV VVRDTPKQPL DVVENSESLL PGAVDDKSEN  300
NNDKFAQGLS PNNLDSRVVF GFVSNSSSPA CLPPQPLANI YCPMENLITL PWSTWYHSTA  360
FPYSSSYNNT VIENFEGLKD EELQREGSLV GSNSGSTGEV NNDNRNSDVV DSKQLSSPGK  420
KECGKGFVPY KRCLAERDDK LSISFLQERE GQRARVCS
Functional Description ? help Back to Top
Source Description
UniProtMorning-phased transcription factor integrating the circadian clock and auxin pathways. Binds to the evening element (EE) of promoters. Does not act within the central clock, but regulates free auxin levels in a time-of-day specific manner. Positively regulates the expression of YUC8 during the day, but has no effect during the night. Negative regulator of freezing tolerance. {ECO:0000269|PubMed:19805390, ECO:0000269|PubMed:23240770}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_011072049.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Circadian-regulation. Peak of transcript abundance near subjective dawn. Down-regulated and strongly decreased amplitude of circadian oscillation upon cold treatment. {ECO:0000269|PubMed:19805390, ECO:0000269|PubMed:23240770}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020548215.10.0protein REVEILLE 7-like isoform X2
SwissprotF4KGY63e-48RVE1_ARATH; Protein REVEILLE 1
TrEMBLA0A4D8ZQC51e-130A0A4D8ZQC5_SALSN; Circadian clock associated 1
STRINGMigut.O00255.1.p1e-106(Erythranthe guttata)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G17300.11e-44MYB_related family protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Xu G, et al.
    REVEILLE1 promotes NADPH: protochlorophyllide oxidoreductase A expression and seedling greening in Arabidopsis.
    Photosyn. Res., 2015. 126(2-3): p. 331-40
    [PMID:25910753]
  3. Jiang Z,Xu G,Jing Y,Tang W,Lin R
    Phytochrome B and REVEILLE1/2-mediated signalling controls seed dormancy and germination in Arabidopsis.
    Nat Commun, 2016. 7: p. 12377
    [PMID:27506149]