PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011072039.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family HD-ZIP
Protein Properties Length: 717aa    MW: 79142.9 Da    PI: 6.7614
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011072039.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox597.7e-192782156
                    TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox  1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                    +++ +++t++q+++Le++F+++++p++++r  L+++l L  rq+k+WFqNrR+++k
  XP_011072039.1 27 KKRYHRHTAHQIQRLEAMFKECPHPDEKTRNLLSRELALHPRQIKFWFQNRRTQMK 82
                    678899***********************************************998 PP

2START168.83.7e-532264502205
                     HHHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS.......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EEEEE CS
           START   2 laeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv......dsgealrasgvvdmvlallveellddkeqWdetla....kaetl 82 
                     +a  a++el+++ +++ep+W+ks+    e++n + + ++f++ ++       + ea+r+sgvv+     lve +ld + +W e ++    +a t+
  XP_011072039.1 226 IAANAMDELIRLLQSNEPLWMKSAgdgrEILNLESYDRIFPRPNShlknpsIRNEASRDSGVVIIHGLGLVEMFLDAS-KWVEFFPtivaRARTV 319
                     67889***********************************9988899*999999************************.******99999***** PP

                     EEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEEEEEEEE-E CS
           START  83 evissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskvtwvehv 170
                     evissg      g+lqlm+ elq+ls lvp R  +f+R+++q ++g+w+ivdvS d + + +  ss  +a++lpSg+li++++ng+skvtwveh+
  XP_011072039.1 320 EVISSGvlgsqsGTLQLMYEELQVLSALVPtRQLYFLRFCQQIEQGSWAIVDVSYDIPHQGSHFSSPCKAHRLPSGCLIQEMPNGYSKVTWVEHW 414
                     *************************************************************9988889*************************** PP

                     E--SSXX.HHHHHHHHHHHHHHHHHHHHHHTXXXXX CS
           START 171 dlkgrlp.hwllrslvksglaegaktwvatlqrqce 205
                     +++++ p h l+r l++sgla+ga +w++tlqr  e
  XP_011072039.1 415 EVEDKAPiHRLYRDLIHSGLAFGAERWLSTLQRMSE 450
                     ********************************9877 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466893.01E-191184IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.0E-211386IPR009057Homeodomain-like
PROSITE profilePS5007116.7952484IPR001356Homeobox domain
SMARTSM003893.2E-172588IPR001356Homeobox domain
CDDcd000863.86E-172685No hitNo description
PfamPF000462.2E-162782IPR001356Homeobox domain
PROSITE patternPS0002705982IPR017970Homeobox, conserved site
PROSITE profilePS5084847.342216454IPR002913START domain
SuperFamilySSF559613.07E-32217452No hitNo description
CDDcd088756.92E-116220450No hitNo description
SMARTSM002342.0E-45225451IPR002913START domain
PfamPF018523.5E-44226450IPR002913START domain
Gene3DG3DSA:3.30.530.202.0E-5321444IPR023393START-like domain
SuperFamilySSF559611.69E-21473709No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009828Biological Processplant-type cell wall loosening
GO:0010091Biological Processtrichome branching
GO:0005634Cellular Componentnucleus
GO:0000976Molecular Functiontranscription regulatory region sequence-specific DNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008289Molecular Functionlipid binding
Sequence ? help Back to Top
Protein Sequence    Length: 717 aa     Download sequence    Send to blast
MMEFSSGGGG GSSGGDHQDA SDPHRRKKRY HRHTAHQIQR LEAMFKECPH PDEKTRNLLS  60
RELALHPRQI KFWFQNRRTQ MKAQHERADN CALRAENDKI RCENIAIREA LKNVICPSCG  120
GPPVSEDSYF DEQKLRMENA QLKEELDRVS SIAAKYIGRP ISQLPPVQPI HVSSLDLSMA  180
SFGGHGIPGP SLDLDLLPGS STSVIPNLAF PSMSISDMDK SLMADIAANA MDELIRLLQS  240
NEPLWMKSAG DGREILNLES YDRIFPRPNS HLKNPSIRNE ASRDSGVVII HGLGLVEMFL  300
DASKWVEFFP TIVARARTVE VISSGVLGSQ SGTLQLMYEE LQVLSALVPT RQLYFLRFCQ  360
QIEQGSWAIV DVSYDIPHQG SHFSSPCKAH RLPSGCLIQE MPNGYSKVTW VEHWEVEDKA  420
PIHRLYRDLI HSGLAFGAER WLSTLQRMSE RFACLIVTAN STRDLGGVIP SLEGKRSMMK  480
LAQRMVNNFC SSINPASGQQ WTTLSGLNEF EVRATVHRII DPGQPNGVVL SAAATIWLPV  540
PPQNVFNFFK DERSRPQWDV LSNQNPVQEV AHIANGSHPG NCISVLRALN TSQNNMLILQ  600
ESCIDSSGSL VVYCPIDLPA INIAMSGEDP SYIPLLPSGF TITSDGRADH LQASGGDGAS  660
TSSNLDRSSG SLITVVFQIL VSNLPTARMS PESITTVNNL ISNTIHQIKS ALNCATS
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00232DAPTransfer from AT1G73360Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011072039.10.0PREDICTED: homeobox-leucine zipper protein HDG11-like
SwissprotQ9FX310.0HDG11_ARATH; Homeobox-leucine zipper protein HDG11
TrEMBLA0A068TTE00.0A0A068TTE0_COFCA; Uncharacterized protein
STRINGVIT_17s0053g00780.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA24902351
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G73360.10.0homeodomain GLABROUS 11