PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011071760.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family MYB_related
Protein Properties Length: 315aa    MW: 34676.2 Da    PI: 6.797
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011071760.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding34.93.6e-1171111345
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      ++T+eE+el +++++  G++ W  Ia+ ++ gRt++++k  w+
   XP_011071760.1  71 SFTPEEEELVIQLHAAIGSR-WPIIAQQLP-GRTDNDVKVLWN 111
                      79******************.*********.*******97776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500905.448962IPR017877Myb-like domain
SuperFamilySSF466893.89E-1448122IPR009057Homeodomain-like
PROSITE profilePS5129416.91464118IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.6E-1667118IPR009057Homeodomain-like
SMARTSM007177.2E-968116IPR001005SANT/Myb domain
PfamPF002493.9E-1070112IPR001005SANT/Myb domain
CDDcd001672.15E-771114No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 315 aa     Download sequence    Send to blast
MVKTACSDKL HAPKGRWDDE GDGKTGTYAS RGHGTGNWAT FSRRSGQRRS GKSGRERWSS  60
SNQKADPRHK SFTPEEEELV IQLHAAIGSR WPIIAQQLPG RTDNDVKVLW NSKLRKKLSA  120
MGIDPVTHKP FSQILADYGN IGAFPKARTR FSSLSRDLKN AIMSKPDQSQ RHAQASSTPD  180
HHTSSSANTT LDLYSQLEAI NLVSEASNHA STDTCTRQVS PPLTVNQEVS SFSWSDFLLE  240
DAFLPSEPDE QENKGIVLQG GNIQGNGVAN AMVIKNFEAS SSSNSSSFVE AMVDSQDCDV  300
FSQLPAAFYE EPFYY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-13141187108B-MYB
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_011071760.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011071760.10.0transcription factor MYB35-like isoform X2
TrEMBLA0A2G9G2091e-125A0A2G9G209_9LAMI; Transcription factor, Myb superfamily
STRINGMigut.I00107.1.p2e-99(Erythranthe guttata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA123481922
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G28470.11e-37MYB family protein