PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011071651.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family GRAS
Protein Properties Length: 493aa    MW: 55739.7 Da    PI: 6.2018
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011071651.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS251.33.8e-771204842374
            GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshl 96 
                     ++ Ll++Ae ++++++ +a++lL r   l+s++++p++R++++f+eAL++r+  +  ++    +  + + ++  +   a+ ++ +  P  +++++
  XP_011071651.1 120 TSYLLNAAEKFANQQFDCAEKLLRRCILLSSNADSPVERVVKFFAEALRERVDIERGKIDLHKNIFHLE-DTLFDYHPAVLALEQKLPSAQVTQF 213
                     5789***********************************************998555555444555554.456777778888************* PP

            GRAS  97 taNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRp.egppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledle 190
                     ta qa+l+ v  ++++H +Df+i+ Gl+W  ++q La+R+  +   l+iT+vg     sk +leetg+rL++fAe+++++f +++ v+++++ l+
  XP_011071651.1 214 TAIQAVLDGVGMARKIHLVDFGIKTGLHWSIMMQGLANREnCQLELLKITAVGT----SKVRLEETGRRLSSFAESMNLSFLYKT-VVSETKGLK 303
                     ****************************************445669********....9**************************.7999***** PP

            GRAS 191 leeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikv 285
                      ++++++p+E++aV + l l + l      +++ +e+L++vk+lsP v+vv e ea++n++ F +rf  al++  a fd+l++ l  ++  r+ +
  XP_011071651.1 304 KDSFEFDPDEVVAVYSGLCLWSQLV----WPNQLKEFLQFVKNLSPCVIVVNEIEASTNTSIFIDRFHGALSFTIATFDCLDTCLKGKTIYRKII 394
                     ******************9988884....4445566*********************************************************** PP

            GRAS 286 ErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgslvlgWkdrpLvsvSaWr 374
                     E ++++  i+n++++e +er+ rh +   Wre + e+    v+ls+++  qa+ll++  + +d  +++ + + +v+gWk+ pL s+SaW+
  XP_011071651.1 395 EDVFFRAMIRNIITAEDEERIYRHAKICFWRELFAEFNIVGVELSDSILYQARLLIKGNAaWDSCTLDVNGNYMVMGWKGTPLQSISAWK 484
                     ************************************************************9999*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098535.40593463IPR005202Transcription factor GRAS
PfamPF035141.3E-74120484IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 493 aa     Download sequence    Send to blast
MASQCEETKT ETDNGSPSVV SHHAGAKNEV PWTPQPPFEI LNKYASHIKR FRCGKIISPA  60
PETTVGRFPG QELSADSILA LAKMRLLQHT SQSTGDSNSG YPINYDPDLS SENYKDVELT  120
SYLLNAAEKF ANQQFDCAEK LLRRCILLSS NADSPVERVV KFFAEALRER VDIERGKIDL  180
HKNIFHLEDT LFDYHPAVLA LEQKLPSAQV TQFTAIQAVL DGVGMARKIH LVDFGIKTGL  240
HWSIMMQGLA NRENCQLELL KITAVGTSKV RLEETGRRLS SFAESMNLSF LYKTVVSETK  300
GLKKDSFEFD PDEVVAVYSG LCLWSQLVWP NQLKEFLQFV KNLSPCVIVV NEIEASTNTS  360
IFIDRFHGAL SFTIATFDCL DTCLKGKTIY RKIIEDVFFR AMIRNIITAE DEERIYRHAK  420
ICFWRELFAE FNIVGVELSD SILYQARLLI KGNAAWDSCT LDVNGNYMVM GWKGTPLQSI  480
SAWKIHEQNN QHD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A6e-3814948433375GRAS family transcription factor containing p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011071651.10.0PREDICTED: DELLA protein RGL1-like
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA85001728
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G66350.13e-46RGA-like 1