PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011071017.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family HD-ZIP
Protein Properties Length: 292aa    MW: 33248.5 Da    PI: 6.3508
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011071017.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox566.6e-1885138356
                     --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                     k+++++ eq+++Le+ Fe  +++  e++ +LA+ lgL+ rq+ +WFqNrRa++k
  XP_011071017.1  85 KKRRLNMEQVKTLEKNFELGNKLEPERKMQLARALGLQPRQIAIWFQNRRARWK 138
                     456899***********************************************9 PP

2HD-ZIP_I/II130.28.2e-4284176193
     HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelke 93 
                     ekkrrl+ eqvk+LE++Fe  +kLeperK++lar+Lglqprq+a+WFqnrRAR+ktkqlEkdy+ Lkr+++a+k+en++L++++++L++e+++
  XP_011071017.1  84 EKKRRLNMEQVKTLEKNFELGNKLEPERKMQLARALGLQPRQIAIWFQNRRARWKTKQLEKDYDLLKRQFEAVKAENDALQAQNQKLHAEIMA 176
                     69**************************************************************************************99975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.97E-1975142IPR009057Homeodomain-like
PROSITE profilePS5007117.11980140IPR001356Homeobox domain
SMARTSM003891.8E-1783144IPR001356Homeobox domain
CDDcd000865.75E-1685141No hitNo description
PfamPF000462.9E-1585138IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.604.9E-1987147IPR009057Homeodomain-like
PRINTSPR000311.2E-5111120IPR000047Helix-turn-helix motif
PROSITE patternPS000270115138IPR017970Homeobox, conserved site
PRINTSPR000311.2E-5120136IPR000047Helix-turn-helix motif
PfamPF021833.7E-16140181IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009744Biological Processresponse to sucrose
GO:0048826Biological Processcotyledon morphogenesis
GO:0080022Biological Processprimary root development
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 292 aa     Download sequence    Send to blast
MSTEMAFFHP NFMLQTPHQD EHTHPSTSLP PLLPSCSTPQ EFHGVAPLLG KRSSMGFSTG  60
IDVCEEMNNH GEDELSDDGS QVGEKKRRLN MEQVKTLEKN FELGNKLEPE RKMQLARALG  120
LQPRQIAIWF QNRRARWKTK QLEKDYDLLK RQFEAVKAEN DALQAQNQKL HAEIMALKNK  180
EPTESINLNK ETEGSCSNRS ENSSEIKLDI SRTPAIDSPL PAHPTNAGRP LFPSSLIRPS  240
GVAQQLFHNP SRPEIQCPKM DQSVKEESLC NMFCGMDDQT GFWPWLEQQH FN
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1132140RRARWKTKQ
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00225DAPTransfer from AT1G69780Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011071017.10.0PREDICTED: homeobox-leucine zipper protein ATHB-13
SwissprotQ8LC031e-124ATB13_ARATH; Homeobox-leucine zipper protein ATHB-13
TrEMBLA0A0S2T0071e-167A0A0S2T007_VITVI; Homodomain-leucine zipper protein ATHB-13-like protein
STRINGVIT_01s0026g01950.t011e-165(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA8482498
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69780.11e-112HD-ZIP family protein