PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011070725.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family HD-ZIP
Protein Properties Length: 212aa    MW: 24006.4 Da    PI: 8.6052
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011070725.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox62.37.2e-2068122256
                     T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                     rk+ ++tk+q + Lee F+ n++++ +++e LA++l+L+ rqV vWFqNrRa+ k
  XP_011070725.1  68 RKKLRLTKDQSRLLEESFRLNHTLNPKQKEALAQQLNLKPRQVEVWFQNRRARSK 122
                     78889************************************************98 PP

2HD-ZIP_I/II118.92.8e-3868156189
     HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLre 89 
                     +kk+rl+k+q++lLEesF+ +++L+p++K++la++L+l+prqv+vWFqnrRAR k+kq+E+++e+Lkr++ +l+e+n++L+keveeLr+
  XP_011070725.1  68 RKKLRLTKDQSRLLEESFRLNHTLNPKQKEALAQQLNLKPRQVEVWFQNRRARSKLKQTEMECEYLKRWFGSLTEQNRKLQKEVEELRA 156
                     69*************************************************************************************94 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.1E-1943125IPR009057Homeodomain-like
SuperFamilySSF466891.17E-1958125IPR009057Homeodomain-like
PROSITE profilePS5007117.62164124IPR001356Homeobox domain
SMARTSM003892.3E-1866128IPR001356Homeobox domain
CDDcd000861.54E-1767125No hitNo description
PfamPF000463.5E-1768122IPR001356Homeobox domain
PROSITE patternPS00027099122IPR017970Homeobox, conserved site
PfamPF021832.9E-10124158IPR003106Leucine zipper, homeobox-associated
SMARTSM003405.2E-21124167IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 212 aa     Download sequence    Send to blast
MENFRNNSSC LELSIAMPGF SSSPSGEMGG MAVKGGVDIN QVASSGTEEE CMEEEDEISR  60
NDGGPTPRKK LRLTKDQSRL LEESFRLNHT LNPKQKEALA QQLNLKPRQV EVWFQNRRAR  120
SKLKQTEMEC EYLKRWFGSL TEQNRKLQKE VEELRAMKVG PPHGRHPLPP STLTMCPRCE  180
RVTTTTLLEK SPTTTPPATK MPFLQPPASC YN
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1116124RRARSKLKQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription repressor that binds to the DNA sequence 5'-CAAT[GC]ATTG-3'. {ECO:0000269|PubMed:10732669}.
UniProtProbable transcription repressor that binds to the DNA sequence 5'-CAAT[GC]ATTG-3'. {ECO:0000269|PubMed:10732669}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_011070725.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ0619053e-48KJ061905.1 Sesamum indicum clone TilSSR_33106 microsatellite Sesame_33106 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011070725.11e-156homeobox-leucine zipper protein HOX3
SwissprotQ0JKX13e-74HOX3_ORYSJ; Homeobox-leucine zipper protein HOX3
SwissprotQ9XH383e-74HOX3_ORYSI; Homeobox-leucine zipper protein HOX3
TrEMBLA0A2G9HFF88e-90A0A2G9HFF8_9LAMI; Transcription factor HEX
STRINGcassava4.1_022041m6e-84(Manihot esculenta)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA29024186
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01430.14e-71homeobox-leucine zipper protein 17