PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011070518.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family BBR-BPC
Protein Properties Length: 281aa    MW: 31204.8 Da    PI: 10.1112
Description BBR-BPC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011070518.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GAGA_bind333.74.7e-10212811301
       GAGA_bind   1 mdddgsrernkgyyepaaslkenlglqlmssiaerdaki....rernlalsekkaavaerd..........maflqrdkalaernkalverdnkl 81 
                     md+d+   rn+gyyep   lk +lglqlmss+a+rd+k+    r++ + + + ++a+++rd          m++  rd+++++        ++k+
  XP_011070518.1   1 MDEDSL--RNWGYYEPP--LKGHLGLQLMSSVADRDTKPflsgRDNPV-MVSANGAFHPRDcmvteppvthMDY-VRDSWINH--------REKF 81 
                     788855..9********..**********************9776666.99***********************.9******9........7899 PP

       GAGA_bind  82 lalllvenslasalpvgvqvlsgtksidslqqlsepqledsavelreeeklealpieeaaeeakekkkkkkrqrakkpkekkakkkkkksekskk 176
                     l++ + +       p +    + + + +s+ ++++p++++++ +           +e+ + +++     kkrq a++pk++k kk++k ++++k+
  XP_011070518.1  82 LHMFPGN-------PYNPVLAEPSGTHHSMTMVHQPDTTKETRP----------SMEDPNVKKEGGGPAKKRQAAATPKTPKGKKPRK-GPAPKE 158
                     9999933.......333333444445555666555544444333..........3334444455566778899999**********99.788988 PP

       GAGA_bind 177 kvkkesaderskaekksidlvlngvslDestlPvPvCsCtGalrqCYkWGnGGWqSaCCtttiSvyPLPvstkrrgaRiagrKmSqgafkklLek 271
                     + +++   +r+k+ kk++++v+ng+++D++++P+PvCsCtG+++qCY+WG+GGWqSaCCtttiS+yPLP+stkrrgaRiagrKmSqgafkk+Lek
  XP_011070518.1 159 NGNPSV--QRAKTAKKNVEVVINGIDMDITGIPIPVCSCTGTPQQCYRWGCGGWQSACCTTTISMYPLPMSTKRRGARIAGRKMSQGAFKKVLEK 251
                     888887..79************************************************************************************* PP

       GAGA_bind 272 LaaeGydlsnpvDLkdhWAkHGtnkfvtir 301
                     LaaeGy+++np+DL+++WAkHGtnkfv ir
  XP_011070518.1 252 LAAEGYNFANPIDLRTYWAKHGTNKFVIIR 281
                     ****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012262.6E-1661281IPR010409GAGA-binding transcriptional activator
PfamPF062171.7E-1124281IPR010409GAGA-binding transcriptional activator
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009723Biological Processresponse to ethylene
GO:0050793Biological Processregulation of developmental process
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 281 aa     Download sequence    Send to blast
MDEDSLRNWG YYEPPLKGHL GLQLMSSVAD RDTKPFLSGR DNPVMVSANG AFHPRDCMVT  60
EPPVTHMDYV RDSWINHREK FLHMFPGNPY NPVLAEPSGT HHSMTMVHQP DTTKETRPSM  120
EDPNVKKEGG GPAKKRQAAA TPKTPKGKKP RKGPAPKENG NPSVQRAKTA KKNVEVVING  180
IDMDITGIPI PVCSCTGTPQ QCYRWGCGGW QSACCTTTIS MYPLPMSTKR RGARIAGRKM  240
SQGAFKKVLE KLAAEGYNFA NPIDLRTYWA KHGTNKFVII R
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00253DAPTransfer from AT2G01930Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011070518.10.0PREDICTED: protein BASIC PENTACYSTEINE1-like
SwissprotQ9SKD01e-105BPC1_ARATH; Protein BASIC PENTACYSTEINE1
TrEMBLA0A022QNC41e-160A0A022QNC4_ERYGU; Uncharacterized protein
STRINGVIT_01s0011g06380.t011e-148(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA90612429
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01930.24e-98basic pentacysteine1