PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011070327.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family HD-ZIP
Protein Properties Length: 817aa    MW: 90634.7 Da    PI: 5.3959
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011070327.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox63.53e-2092147156
                     TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                     +++ +++t+ q++e+e+lF+++++p+ ++r +L+++lgL+ rqVk+WFqNrR+++k
  XP_011070327.1  92 KKRYHRHTTRQIQEMEALFKECPHPDDKQRLKLSQELGLKPRQVKFWFQNRRTQMK 147
                     688999***********************************************998 PP

2START146.42.6e-462925172206
                     HHHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS........SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EEEE CS
           START   2 laeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv.......dsgealrasgvvdmvlallveellddkeqWdetla....kaet 81 
                     la + ++elvk+   +ep+Wv  +    + +n +e+ + f+ s +       +++ea r ++vv+m++ +lv  +ld + +W e ++    +a+t
  XP_011070327.1 292 LAVSSMDELVKMCHTAEPLWVPAAdtgkQVLNLEEYARMFSWSANlkqhspqFRTEATRHTAVVIMNSITLVDAFLDAN-KWMELFPciisRAKT 385
                     57789*******************88888888888888888777799999*****************************.*************** PP

                     EEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE..TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEEEEEEEE CS
           START  82 levissg......galqlmvaelqalsplvp.RdfvfvRyirq.lgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskvtwve 168
                     l+v+ s       g l+lm+ae q+lsplvp R+  f+Ry++   ++g+w+ivd  +d   +    +s++  +++pSg++i++++ng+s+vtwve
  XP_011070327.1 386 LQVVHSEvsghanGSLHLMYAEVQVLSPLVPtREAHFLRYCQHnAEEGTWAIVDFPLDGLHNDY-PPSFAYYKRRPSGCIIQDMPNGYSRVTWVE 479
                     *******************************************9**************666555.45788888********************** PP

                     -EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
           START 169 hvdlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                     h+++++  +h+++ slv+sg+a+ga++w+a lqrqce+
  XP_011070327.1 480 HAEVEDGPIHQVFSSLVSSGAAFGAQRWLAVLQRQCER 517
                     ************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.4E-2079143IPR009057Homeodomain-like
SuperFamilySSF466891.28E-1980150IPR009057Homeodomain-like
PROSITE profilePS5007117.23289149IPR001356Homeobox domain
SMARTSM003891.6E-1890153IPR001356Homeobox domain
PfamPF000461.1E-1792147IPR001356Homeobox domain
CDDcd000869.57E-1992150No hitNo description
PROSITE patternPS000270124147IPR017970Homeobox, conserved site
PROSITE profilePS5084843.373282520IPR002913START domain
SuperFamilySSF559613.39E-32283519No hitNo description
CDDcd088755.71E-116286516No hitNo description
SMARTSM002343.7E-34291517IPR002913START domain
PfamPF018521.3E-38293517IPR002913START domain
SuperFamilySSF559615.93E-17535775No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048497Biological Processmaintenance of floral organ identity
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 817 aa     Download sequence    Send to blast
MFGDCQVLSA MGGNGMPSDN ALYSTSMQHP NTTFMPAINP FNIFSPIIPQ KEEITGMAKS  60
KEELMESGSG SEHIEGFSGN EQEAEQQPQA KKKRYHRHTT RQIQEMEALF KECPHPDDKQ  120
RLKLSQELGL KPRQVKFWFQ NRRTQMKAQQ DRQDNVVLRA ENESLKNENY RLQATLRNIV  180
CPNCGGPAMM GEMGYDEQQL RIENARLKEE LERMCCLVSQ YTGRPMPGMG PPPLLPTSLD  240
LDVSSYPRKF EQDHMTNCPP DHMIPLPFMP ENSQFPGNAL ILEEERPLAL DLAVSSMDEL  300
VKMCHTAEPL WVPAADTGKQ VLNLEEYARM FSWSANLKQH SPQFRTEATR HTAVVIMNSI  360
TLVDAFLDAN KWMELFPCII SRAKTLQVVH SEVSGHANGS LHLMYAEVQV LSPLVPTREA  420
HFLRYCQHNA EEGTWAIVDF PLDGLHNDYP PSFAYYKRRP SGCIIQDMPN GYSRVTWVEH  480
AEVEDGPIHQ VFSSLVSSGA AFGAQRWLAV LQRQCERLAS LMARNISDLG VIPSPEARKS  540
LMNLAQRMTR TFCLNISTSY GQSWTALSDC ADDTVRITTR KVTEPGQPNG LILSAVSTTW  600
LPYQHNQVFD FLRDERRRAQ LEVLSNGNSL HEVAHIANGS HPGNCISLLR INVASNSSQS  660
VELVLQESCS DDSGSIVVYT TIDVDAIQMA MNGEDPSCIP LLPLGFVIVP MGQIANNDSG  720
IADSKQASEN GHLPDSGCLL TVGLQVLAST IPSAKLNLSS VTAINHHLCN TVQQINAVLG  780
NISGNNFSEN VDVLGSNIDP EPALPAENKP TDPCATS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011070327.10.0PREDICTED: homeobox-leucine zipper protein HDG5 isoform X1
RefseqXP_011070328.10.0PREDICTED: homeobox-leucine zipper protein HDG5 isoform X1
SwissprotA2ZAI70.0ROC3_ORYSI; Homeobox-leucine zipper protein ROC3
TrEMBLA0A0V0IWB50.0A0A0V0IWB5_SOLCH; Putative homeobox-leucine zipper protein HDG5-like
STRINGVIT_02s0012g02030.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA90202226
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G46880.10.0homeobox-7