PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011070327.1
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family HD-ZIP
Protein Properties Length: 817aa    MW: 90634.7 Da    PI: 5.3959
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011070327.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
        Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                     +++ +++t+ q++e+e+lF+++++p+ ++r +L+++lgL+ rqVk+WFqNrR+++k
                     688999***********************************************998 PP

           START   2 laeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv.......dsgealrasgvvdmvlallveellddkeqWdetla....kaet 81 
                     la + ++elvk+   +ep+Wv  +    + +n +e+ + f+ s +       +++ea r ++vv+m++ +lv  +ld + +W e ++    +a+t
                     57789*******************88888888888888888777799999*****************************.*************** PP

           START  82 levissg......galqlmvaelqalsplvp.RdfvfvRyirq.lgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskvtwve 168
                     l+v+ s       g l+lm+ae q+lsplvp R+  f+Ry++   ++g+w+ivd  +d   +    +s++  +++pSg++i++++ng+s+vtwve
                     *******************************************9**************666555.45788888********************** PP

           START 169 hvdlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                     h+++++  +h+++ slv+sg+a+ga++w+a lqrqce+
                     ************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007117.23289149IPR001356Homeobox domain
SMARTSM003891.6E-1890153IPR001356Homeobox domain
PfamPF000461.1E-1792147IPR001356Homeobox domain
CDDcd000869.57E-1992150No hitNo description
PROSITE patternPS000270124147IPR017970Homeobox, conserved site
PROSITE profilePS5084843.373282520IPR002913START domain
SuperFamilySSF559613.39E-32283519No hitNo description
CDDcd088755.71E-116286516No hitNo description
SMARTSM002343.7E-34291517IPR002913START domain
PfamPF018521.3E-38293517IPR002913START domain
SuperFamilySSF559615.93E-17535775No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048497Biological Processmaintenance of floral organ identity
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 817 aa     Download sequence    Send to blast
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011070327.10.0homeobox-leucine zipper protein HDG5 isoform X1
RefseqXP_011070328.10.0homeobox-leucine zipper protein HDG5 isoform X1
SwissprotA2ZAI70.0ROC3_ORYSI; Homeobox-leucine zipper protein ROC3
TrEMBLA0A2G9HN190.0A0A2G9HN19_9LAMI; Transcription factor, contains HOX domain
STRINGMigut.E00753.1.p0.0(Erythranthe guttata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description