PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011070186.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family HD-ZIP
Protein Properties Length: 231aa    MW: 25740.7 Da    PI: 9.0214
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011070186.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox60.92e-1997151256
                     T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                     rk+ ++t++q++ Le+ F+++ ++++++++ LA+kl+L+ rqV vWFqNrRa+ k
  XP_011070186.1  97 RKKLRLTRDQITLLEDSFRQHTTLNTAQKQTLAEKLNLKPRQVEVWFQNRRARTK 151
                     788899***********************************************98 PP

2HD-ZIP_I/II112.52.7e-3697188192
     HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92 
                     +kk+rl+++q++lLE+sF+++++L++ +K++la++L+l+prqv+vWFqnrRARtk+kq+E+d e+Lk+++++l+een+rL+ke +eLr+ lk
  XP_011070186.1  97 RKKLRLTRDQITLLEDSFRQHTTLNTAQKQTLAEKLNLKPRQVEVWFQNRRARTKLKQTEVDREFLKKNCERLSEENRRLKKELTELRSLLK 188
                     69*************************************************************************************98765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.2E-1880154IPR009057Homeodomain-like
SuperFamilySSF466891.04E-1885154IPR009057Homeodomain-like
PROSITE profilePS5007117.36293153IPR001356Homeobox domain
SMARTSM003897.9E-1595157IPR001356Homeobox domain
PfamPF000461.0E-1697151IPR001356Homeobox domain
CDDcd000868.22E-1497154No hitNo description
PROSITE patternPS000270128151IPR017970Homeobox, conserved site
SMARTSM003407.3E-13153197IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 231 aa     Download sequence    Send to blast
MDDENDEARL GLGLGLGSSE CTPKRDHSRK NKRVFFLDLS IPLHPSDDHG TSADDDSSSS  60
LKIIGDENEK QGCKNYGSFS CKDQDDDSIN CSKDFSRKKL RLTRDQITLL EDSFRQHTTL  120
NTAQKQTLAE KLNLKPRQVE VWFQNRRART KLKQTEVDRE FLKKNCERLS EENRRLKKEL  180
TELRSLLKIE NPPAAAASSP GGGGAGAAEK SGKRLRVAAG GPRTLNLNDG G
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
195101SRKKLRL
2145153RRARTKLKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011070186.11e-168PREDICTED: homeobox-leucine zipper protein HOX17-like
TrEMBLA0A022RC481e-77A0A022RC48_ERYGU; Uncharacterized protein
STRINGPOPTR_0018s13300.11e-49(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA1613945
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06710.15e-40homeobox from Arabidopsis thaliana