PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011069877.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family CO-like
Protein Properties Length: 378aa    MW: 41317.6 Da    PI: 7.0926
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011069877.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box223.3e-072663439
        zf-B_box  4 rkCpeHeekelqlfCedCqqllCedClleeHkg..Htv 39
                    + C+ +++  + lfC+ +++++C  C  + H +  H++
  XP_011069877.1 26 KPCDYCKSAAALLFCRADSVFMCIACDAKVHDNmkHER 63
                    57*******9*********************7788986 PP

2zf-B_box25.43e-0864108341
        zf-B_box   3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htvvp 41 
                      ++C+ +e+ ++   C+ +   lC +C   +H+       H++v 
  XP_011069877.1  64 VWMCEVCEQAPAAVTCKADAAALCVTCDRDIHSAnplagrHERVA 108
                     689*****************************6688888898775 PP

3CCT70.73.6e-24306349144
             CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                     Rea++lRYkeKrk+RkFeK+irY+sRKa+Ae+RpR+KGrF+k++
  XP_011069877.1 306 REARVLRYKEKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRT 349
                     9*****************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003361.5E-52366IPR000315B-box-type zinc finger
PfamPF006431.0E-52663IPR000315B-box-type zinc finger
CDDcd000217.09E-82766No hitNo description
PROSITE profilePS501199.5562866IPR000315B-box-type zinc finger
PROSITE profilePS501199.96862109IPR000315B-box-type zinc finger
PfamPF006432.4E-664108IPR000315B-box-type zinc finger
CDDcd000211.00E-865107No hitNo description
SMARTSM003364.1E-967109IPR000315B-box-type zinc finger
PfamPF062033.9E-18306348IPR010402CCT domain
PROSITE profilePS5101716.638306348IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 378 aa     Download sequence    Send to blast
MGIAQDGGGA ARPKFFPAAA LNVVAKPCDY CKSAAALLFC RADSVFMCIA CDAKVHDNMK  60
HERVWMCEVC EQAPAAVTCK ADAAALCVTC DRDIHSANPL AGRHERVAVV PFYETAESVV  120
MKSAAAALLV PAGDCNSNIF VADHPSQPDR KLDTNGYIPD SWIPTSPIIT AKLPAEAPDL  180
KSMELLFQDS DQFIDFENYQ ISSQPYSDSV VPVQTTIKPP APARLTRDHS SENRFEIDFT  240
RSNINAYNSS YTTASLSHSV SSSSMDVGVV PDGSALSEIS YPFSRNINSS LDLNGNQGSQ  300
VVGMDREARV LRYKEKRKNR KFEKTIRYAS RKAYAETRPR IKGRFAKRTD AESDIDRIFG  360
AGAANFIADA RYGVVPSF
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_011069877.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011069877.10.0zinc finger protein CONSTANS-LIKE 5-like
SwissprotQ9FHH86e-95COL5_ARATH; Zinc finger protein CONSTANS-LIKE 5
TrEMBLA0A2G9HFV00.0A0A2G9HFV0_9LAMI; GATA-4/5/6 transcription factor
STRINGMigut.K00262.1.p1e-147(Erythranthe guttata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA10352376
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G57660.17e-89CONSTANS-like 5
Publications ? help Back to Top
  1. Vercruyssen L, et al.
    ANGUSTIFOLIA3 binds to SWI/SNF chromatin remodeling complexes to regulate transcription during Arabidopsis leaf development.
    Plant Cell, 2014. 26(1): p. 210-29
    [PMID:24443518]