PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sphfalx0442s0002.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Sphagnophytina; Sphagnopsida; Sphagnales; Sphagnaceae; Sphagnum
Family GRAS
Protein Properties Length: 337aa    MW: 36779.9 Da    PI: 4.9219
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sphfalx0442s0002.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS226.21.5e-694026217250
                  GRAS  17 lelaqalLarlselaspdgdpmqRlaayfteALaarlar..svselykalppsetsekn.sseelaalklfsevsPilkfshltaNqaI 102
                           l +a+            +  +m  +aa+f eAL +r+++  s+s+ ++++++   +++n  se l+++  ++e++P+lkfsh+t NqaI
  Sphfalx0442s0002.2.p  40 LVRAE------------ETVTMGEVAAHFIEALTHRIYGgtSSSQDSSSCNVVGYESNNyLSELLHFQ--YYETCPYLKFSHFTSNQAI 114
                           44443............4458999**************954444445555555555555344554443..9****************** PP

                  GRAS 103 leavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledlel 191
                           lea+ege+ vH+iD+++++GlQWpaL+qaLa Rp+gppsl +Tg+g+p++g ++ l+e+g +La++A++++++f+f  +va +l+++++
  Sphfalx0442s0002.2.p 115 LEAFEGEKWVHVIDLNLMHGLQWPALIQALALRPGGPPSLCLTGIGPPQAGGNNGLQEIGMKLAQLAASVNIEFDFWGVVALKLNEVKP 203
                           *******************************************************************************999******* PP

                  GRAS 192 eeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhns 250
                           ++L+v pgE++aVn+vlqlh+ll++++    ++devL+ + +l+Pk+v+vve+ a+hn 
  Sphfalx0442s0002.2.p 204 WMLQVLPGEVVAVNSVLQLHQLLNSDGGPVLAIDEVLHSILGLKPKIVTVVEHKANHNV 262
                           **************************999999*************************95 PP

2GRAS47.82.6e-15287334327374
                  GRAS 327 vplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                           ++l+++a kqaklll+ +++dgy+vee++g+l+lgW++rpL+++SaW+
  Sphfalx0442s0002.2.p 287 ARLGSTALKQAKLLLSLFPGDGYQVEENNGCLTLGWHTRPLIAFSAWQ 334
                           57899******************************************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098535.4161336IPR005202Transcription factor GRAS
PROSITE profilePS512575131No hitNo description
PfamPF035145.3E-6740262IPR005202Transcription factor GRAS
PfamPF035148.9E-13287334IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 337 aa     Download sequence    Send to blast
MMESRNHQRP QVNEDEQEDN GVQLVHSLLA CGEAVQHGDL VRAEETVTMG EVAAHFIEAL  60
THRIYGGTSS SQDSSSCNVV GYESNNYLSE LLHFQYYETC PYLKFSHFTS NQAILEAFEG  120
EKWVHVIDLN LMHGLQWPAL IQALALRPGG PPSLCLTGIG PPQAGGNNGL QEIGMKLAQL  180
AASVNIEFDF WGVVALKLNE VKPWMLQVLP GEVVAVNSVL QLHQLLNSDG GPVLAIDEVL  240
HSILGLKPKI VTVVEHKANH NVSGEQLLAE MYLRQEICNI IACEGVARLG STALKQAKLL  300
LSLFPGDGYQ VEENNGCLTL GWHTRPLIAF SAWQCA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_A2e-4083333378Protein SCARECROW
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcriptional regulator that acts as a repressor of the gibberellin (GA) signaling pathway. Probably acts by participating in large multiprotein complexes that repress transcription of GA-inducible genes. Upon GA application, it is degraded by the proteasome, allowing the GA signaling pathway.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEF6464700.0EF646470.1 Sphagnum palustre DELLA protein (DELLA) gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024361039.11e-142DELLA protein GAI-like
SwissprotQ8S4W71e-104GAI1_VITVI; DELLA protein GAI1
TrEMBLA7U4T40.0A7U4T4_SPHPA; DELLA protein
STRINGPP1S12_244V6.11e-138(Physcomitrella patens)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01570.11e-100GRAS family protein