PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sphfalx0442s0002.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Sphagnophytina; Sphagnopsida; Sphagnales; Sphagnaceae; Sphagnum
Family GRAS
Protein Properties Length: 434aa    MW: 46696.5 Da    PI: 4.3295
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sphfalx0442s0002.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS225.52.6e-6913735917250
                  GRAS  17 lelaqalLarlselaspdgdpmqRlaayfteALaarlar..svselykalppsetsekn.sseelaalklfsevsPilkfshltaNqaI 102
                           l +a+            +  +m  +aa+f eAL +r+++  s+s+ ++++++   +++n  se l+++  ++e++P+lkfsh+t NqaI
  Sphfalx0442s0002.1.p 137 LVRAE------------ETVTMGEVAAHFIEALTHRIYGgtSSSQDSSSCNVVGYESNNyLSELLHFQ--YYETCPYLKFSHFTSNQAI 211
                           44443............4458999**************954444445555555555555344554443..9****************** PP

                  GRAS 103 leavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledlel 191
                           lea+ege+ vH+iD+++++GlQWpaL+qaLa Rp+gppsl +Tg+g+p++g ++ l+e+g +La++A++++++f+f  +va +l+++++
  Sphfalx0442s0002.1.p 212 LEAFEGEKWVHVIDLNLMHGLQWPALIQALALRPGGPPSLCLTGIGPPQAGGNNGLQEIGMKLAQLAASVNIEFDFWGVVALKLNEVKP 300
                           *******************************************************************************999******* PP

                  GRAS 192 eeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhns 250
                           ++L+v pgE++aVn+vlqlh+ll++++    ++devL+ + +l+Pk+v+vve+ a+hn 
  Sphfalx0442s0002.1.p 301 WMLQVLPGEVVAVNSVLQLHQLLNSDGGPVLAIDEVLHSILGLKPKIVTVVEHKANHNV 359
                           **************************999999*************************85 PP

2GRAS474.5e-15385431328374
                  GRAS 328 plsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                           +l+++a kqaklll+ +++dgy+vee++g+l+lgW++rpL+++SaW+
  Sphfalx0442s0002.1.p 385 RLGSTALKQAKLLLSLFPGDGYQVEENNGCLTLGWHTRPLIAFSAWQ 431
                           6899******************************************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF120414.5E-9252IPR021914Transcriptional factor DELLA, N-terminal
PROSITE profilePS5098535.7572433IPR005202Transcription factor GRAS
PfamPF035148.9E-67137359IPR005202Transcription factor GRAS
PfamPF035141.5E-12385431IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 434 aa     Download sequence    Send to blast
MAQRLEQLET VLTAAAAQEA SIAHSSSDGS MALNSSDLSG WIEGMIEELT AANNVPAQRS  60
SPFTADSPYN NNTVEGSSTS LDSFLDTDSP SQVPPLHYQE ALLDNGSAVN EDEQEDNGVQ  120
LVHSLLACGE AVQHGDLVRA EETVTMGEVA AHFIEALTHR IYGGTSSSQD SSSCNVVGYE  180
SNNYLSELLH FQYYETCPYL KFSHFTSNQA ILEAFEGEKW VHVIDLNLMH GLQWPALIQA  240
LALRPGGPPS LCLTGIGPPQ AGGNNGLQEI GMKLAQLAAS VNIEFDFWGV VALKLNEVKP  300
WMLQVLPGEV VAVNSVLQLH QLLNSDGGPV LAIDEVLHSI LGLKPKIVTV VEHKANHNVS  360
GEQLLAEMYL RQEICNIIAC EGVARLGSTA LKQAKLLLSL FPGDGYQVEE NNGCLTLGWH  420
TRPLIAFSAW QCA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_A6e-391094307378Protein SCARECROW
5b3h_A8e-391094306377Protein SCARECROW
5b3h_D8e-391094306377Protein SCARECROW
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcriptional regulator that acts as a repressor of the gibberellin (GA) signaling pathway. Probably acts by participating in large multiprotein complexes that repress transcription of GA-inducible genes. Upon GA application, it is degraded by the proteasome, allowing the GA signaling pathway.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEF6464700.0EF646470.1 Sphagnum palustre DELLA protein (DELLA) gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024361039.11e-157DELLA protein GAI-like
SwissprotQ8S4W71e-106GAI1_VITVI; DELLA protein GAI1
TrEMBLA7U4T40.0A7U4T4_SPHPA; DELLA protein
STRINGPP1S12_244V6.11e-153(Physcomitrella patens)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G03450.11e-101RGA-like 2