PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sphfalx0333s0013.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Sphagnophytina; Sphagnopsida; Sphagnales; Sphagnaceae; Sphagnum
Family GRAS
Protein Properties Length: 572aa    MW: 63015.3 Da    PI: 5.8898
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sphfalx0333s0013.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS456.71.5e-139645691373
                  GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsP 89 
                           l++lLl+cA+av+++++e ++ +L++l  las +gdpmqR+a+yf+e+La+r+++s++++y+al++++ +  +  + l+a+++f+ v+P
  Sphfalx0333s0013.2.p  64 LIQLLLACANAVANNNMEYTNVFLEQLTLLASLTGDPMQRVATYFMEGLATRITKSWPGVYRALNSTQLP--SIMDMLSARQVFFSVCP 150
                           689**************************************************************99999..599************** PP

                  GRAS  90 ilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfef 178
                           +lkfs+lt NqaIl+a+ege+ vH iD+++s ++QW+aLlqaL+ Rp+gpp+lRiTgv++    ++  le+tg+rL++ Ae+l++pf+f
  Sphfalx0333s0013.2.p 151 YLKFSFLTVNQAILDAMEGEKVVHLIDLEASDPVQWLALLQALSVRPGGPPHLRITGVSE----RRAVLEQTGQRLSQEAEKLDIPFQF 235
                           ************************************************************....9************************ PP

                  GRAS 179 nvlvakrledleleeLrvkpgEalaVnlvlqlhrll..................................................... 214
                           ++ v+ +le+l++e Lrvk+gEa+a+++v++lh ll                                                     
  Sphfalx0333s0013.2.p 236 HP-VHAQLENLDVELLRVKTGEAVAISSVMRLHPLLakdhrfsgpgsalgsfdgsshgrmhsprgqsfqrvdclrgecnssrgtcshpq 323
                           **.7999********************************************************************************** PP

                  GRAS 215 ......................................................................................... 214
                                                                                                                    
  Sphfalx0333s0013.2.p 324 qvqvhdravkrpreisdeevelghgsggdsasnaaasagvpadselattgnslvatdgeltserdrsmtnsgsldaqeetgltvreepa 412
                           ************************************************************************************85544 PP

                  GRAS 215 desvsles..erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvace 301
                           +e         +d+vL++++ lsPkv+vvveqe++hn++++lerf+eal+yy a+fdsl++++p++  er+++E++l+g+ei+n+vace
  Sphfalx0333s0013.2.p 413 AEA----GgaVIDRVLRMLRCLSPKVMVVVEQESNHNGPTLLERFIEALHYYCAMFDSLDSTMPQQCLERVTLEKHLFGQEIKNIVACE 497
                           333....244569**************************************************************************** PP

                  GRAS 302 gaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373
                           g er+erhe+lekWr+r+e+aGF+++pls+ a  qa++ll+ ++ dgyr+ e++g+l+l+Wkd pL+s+S+W
  Sphfalx0333s0013.2.p 498 GVERVERHEKLEKWRKRMENAGFEALPLSYPAIVQAERLLHSYACDGYRLLENDGCLTLCWKDTPLYSASSW 569
                           ************************************************************************ PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098562.64338550IPR005202Transcription factor GRAS
PfamPF035145.0E-13764569IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 572 aa     Download sequence    Send to blast
MPGMIRGETP SLSPSSSLSA STQSFWSRSN LSPHHSTLSS VNGPLPTQHL WLQELRSEER  60
GLYLIQLLLA CANAVANNNM EYTNVFLEQL TLLASLTGDP MQRVATYFME GLATRITKSW  120
PGVYRALNST QLPSIMDMLS ARQVFFSVCP YLKFSFLTVN QAILDAMEGE KVVHLIDLEA  180
SDPVQWLALL QALSVRPGGP PHLRITGVSE RRAVLEQTGQ RLSQEAEKLD IPFQFHPVHA  240
QLENLDVELL RVKTGEAVAI SSVMRLHPLL AKDHRFSGPG SALGSFDGSS HGRMHSPRGQ  300
SFQRVDCLRG ECNSSRGTCS HPQQVQVHDR AVKRPREISD EEVELGHGSG GDSASNAAAS  360
AGVPADSELA TTGNSLVATD GELTSERDRS MTNSGSLDAQ EETGLTVREE PAAEAGGAVI  420
DRVLRMLRCL SPKVMVVVEQ ESNHNGPTLL ERFIEALHYY CAMFDSLDST MPQQCLERVT  480
LEKHLFGQEI KNIVACEGVE RVERHEKLEK WRKRMENAGF EALPLSYPAI VQAERLLHSY  540
ACDGYRLLEN DGCLTLCWKD TPLYSASSWH A*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_A4e-45525697378Protein SCARECROW
5b3h_A4e-45525696377Protein SCARECROW
5b3h_D4e-45525696377Protein SCARECROW
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in plant development. {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024381004.10.0scarecrow-like protein 3
RefseqXP_024381005.10.0scarecrow-like protein 3
RefseqXP_024381006.10.0scarecrow-like protein 3
SwissprotQ9LPR82e-86SCL3_ARATH; Scarecrow-like protein 3
TrEMBLA0A2K1K9U30.0A0A2K1K9U3_PHYPA; Uncharacterized protein
STRINGPP1S130_153V6.10.0(Physcomitrella patens)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G50420.11e-80scarecrow-like 3
Publications ? help Back to Top
  1. Gong X, et al.
    SEUSS Integrates Gibberellin Signaling with Transcriptional Inputs from the SHR-SCR-SCL3 Module to Regulate Middle Cortex Formation in the Arabidopsis Root.
    Plant Physiol., 2016. 170(3): p. 1675-83
    [PMID:26818732]
  2. Lee SA, et al.
    Interplay between ABA and GA Modulates the Timing of Asymmetric Cell Divisions in the Arabidopsis Root Ground Tissue.
    Mol Plant, 2016. 9(6): p. 870-84
    [PMID:26970019]
  3. Choi JW,Lim J
    Control of Asymmetric Cell Divisions during Root Ground Tissue Maturation.
    Mol. Cells, 2016. 39(7): p. 524-9
    [PMID:27306644]