PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sphfalx0297s0003.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Sphagnophytina; Sphagnopsida; Sphagnales; Sphagnaceae; Sphagnum
Family GRAS
Protein Properties Length: 768aa    MW: 84408.3 Da    PI: 5.884
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sphfalx0297s0003.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS386.23.7e-1183917611374
                  GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsP 89 
                           l +lLl+cA+av+++d++ +++l+a l++ +s +g++ qR+a+yf+eAL a++++++ +ly al+ ++ s    +e l+a++lf+ ++P
  Sphfalx0297s0003.1.p 391 LNQLLLRCAQAVEQNDFSHTNELIADLRQYSSAYGNAPQRVAHYFMEALVAKMSGTGGQLYTALSNNRPS---AAEMLKAYRLFVGCCP 476
                           5799************************************************************888888...8*************** PP

                  GRAS  90 ilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpf 176
                           ++++sh   N+aIl a+  ++rvHi+D++i +G+QWp+L+  L++ p+gpp+lRiTg+++p++g   +e+++etg+rLa++A+++gvpf
  Sphfalx0297s0003.1.p 477 FIQLSHYFGNSAILHAFGDAKRVHIVDYGILYGVQWPCLIYHLSQLPGGPPHLRITGIDRPQPGfrPSERIQETGHRLARVADHFGVPF 565
                           ***************************************************************************************** PP

                  GRAS 177 efnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyys 265
                           ef++ +a+++e++++ +L ++++E+laVn++++l +lldesv  +s+r+ vL+ ++s++Pk++v    +  +n++ F+ rf eal++ys
  Sphfalx0297s0003.1.p 566 EFHA-IAEKWEAITPAHLFLRNDEVLAVNCIFRLRHLLDESVMAASPRNLVLSRIRSMNPKIFVQGIINGGYNAPFFMSRFQEALSHYS 653
                           ****.7*********************************************************************************** PP

                  GRAS 266 alfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveee 354
                           +lf++l+a++p+e+ +r+ +E+e++grei n+vaceg er+er et+++W++r  +aGF+++p+ ++++++++ l+r ++   y + e+
  Sphfalx0297s0003.1.p 654 TLFEALDASMPAEHPDRVLIEQEFFGREILNIVACEGLERVERAETYRQWQARTLRAGFTQMPIMKTTVEKISNLMRGFHR-NYGIGED 741
                           ********************************************************************************5.5****** PP

                  GRAS 355 sgslvlgWkdrpLvsvSaWr 374
                            g+l+ gWk+  L ++S W+
  Sphfalx0297s0003.1.p 742 GGWLLAGWKETILHAFSTWQ 761
                           *******************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098566.368365742IPR005202Transcription factor GRAS
PfamPF035141.3E-115391761IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009410Biological Processresponse to xenobiotic stimulus
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
Sequence ? help Back to Top
Protein Sequence    Length: 768 aa     Download sequence    Send to blast
MAGSKHDRSG GSGGGGGGGG EVSPLATQLQ QAWLHTQMPK TQKRSLISAP SRQSKSSPDQ  60
SAFKSLSSIF PELAALPQEK KPMIFSVFQE GERPKPEDLE ARKDSFSSCP SFFANITESV  120
PNSTSSTPPR SLPHRSLSAS HVVQSSSSNS SERGAALASF LTTHSFSGSS SHASVAADAN  180
SPDCTESIHS GEGGEVAGSL FNLPADLDPV DSSVTSEGED TNTFYSYLNN LMDDEPEHHK  240
CMFLEATAFQ AMAKELGDLI GDDSLPAWSD SRTSEKDQDV DSWLEEIMRG PFPAEVPEEI  300
KDSSKSFTND EVESLDLGNG DPWYNATDVH RHPEAAGPLR MHPSLDSESL SGGSEDALKH  360
SHVPNRLDSH DSKSTISQQI SIGHQISPVN LNQLLLRCAQ AVEQNDFSHT NELIADLRQY  420
SSAYGNAPQR VAHYFMEALV AKMSGTGGQL YTALSNNRPS AAEMLKAYRL FVGCCPFIQL  480
SHYFGNSAIL HAFGDAKRVH IVDYGILYGV QWPCLIYHLS QLPGGPPHLR ITGIDRPQPG  540
FRPSERIQET GHRLARVADH FGVPFEFHAI AEKWEAITPA HLFLRNDEVL AVNCIFRLRH  600
LLDESVMAAS PRNLVLSRIR SMNPKIFVQG IINGGYNAPF FMSRFQEALS HYSTLFEALD  660
ASMPAEHPDR VLIEQEFFGR EILNIVACEG LERVERAETY RQWQARTLRA GFTQMPIMKT  720
TVEKISNLMR GFHRNYGIGE DGGWLLAGWK ETILHAFSTW QPTPISP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_A4e-5739776225380Protein SCARECROW
5b3h_A3e-5739776224379Protein SCARECROW
5b3h_D3e-5739776224379Protein SCARECROW
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024401598.10.0scarecrow-like protein 30
RefseqXP_024401607.10.0scarecrow-like protein 30
RefseqXP_024401617.10.0scarecrow-like protein 30
TrEMBLA0A2K1L1440.0A0A2K1L144_PHYPA; Uncharacterized protein
STRINGPP1S84_299V6.10.0(Physcomitrella patens)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07530.11e-135SCARECROW-like 14